KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_0724Help
Entry
A7A1_0724         CDS       T02384                                 

Definition
(GenBank) Hypothetical protein YtcI
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
bsl00010  Glycolysis / Gluconeogenesis
bsl00620  Pyruvate metabolism
bsl00630  Glyoxylate and dicarboxylate metabolism
bsl00640  Propanoate metabolism
bsl00680  Methane metabolism
bsl01100  Metabolic pathways
bsl01110  Biosynthesis of secondary metabolites
bsl01120  Microbial metabolism in diverse environments
bsl01130  Biosynthesis of antibiotics
bsl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A7A1_0724
   00620 Pyruvate metabolism
    A7A1_0724
   00630 Glyoxylate and dicarboxylate metabolism
    A7A1_0724
   00640 Propanoate metabolism
    A7A1_0724
  09102 Energy metabolism
   00680 Methane metabolism
    A7A1_0724
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsl01004]
    A7A1_0724
Enzymes [BR:bsl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     A7A1_0724
Lipid biosynthesis proteins [BR:bsl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   A7A1_0724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AGA21342
LinkDB All DBs
Position
1201576..1203171
Genome map
AA seq 531 aa AA seqDB search
MFVLKREDLIAPMQYNLVNEMEKFSAAGQKTALLWEDESGKQVSWSYEKLMEETNKIGAA
LADLGFKKGDKLIVMVPRVLEAYAVYLAILKSGMVVIPCSEMLRAKDLEYRIEHAEVKGA
IVYSEFIGAFRDVSTADKLITLSIGENDAGWKNLLSIEADGSQFKTADTTRDDMAFLSYT
SGTTGQPKGVVHTHGWAFAHLKTSAGAWLDISEKDIVWATAAPGWQKWVWSPFLAVLGSG
ATGFVYHGRFKAEKYLELLNRYKINVFCCTPTEYRLMAKVEGLDRFDLSALHSAVSAGEP
LNREVIDVFQKHFGIKVRDGYGQTESTLLVGVLKDTPIKPGSMGKPTPGNQVEIINEDGE
ICKTGEVGDIAVHLSTPAIFKEYFKDPERMKTQIRGDYFLTGDRARKDEEGYFWFESRND
DIIISSGYTIGPFEVEDALVKHPEVKECAVVASPDEIRGSIVKAYVVLQNHEKRSDELVK
MLQNHVKTITAPYKYPREIEFVESLPKTASAKIRRVELRKREEQLKANKKA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgtgttaaaacgtgaagatttaattgcccctatgcaatataatttagtgaatgaa
atggaaaagttcagtgccgctggacaaaaaaccgctcttctgtgggaggacgagtcgggt
aagcaagtatcttggtcgtatgaaaagctgatggaagaaacaaataaaatcggagcggcc
ttagctgatcttggatttaaaaagggagacaagctgattgtaatggttccgcgggtgctt
gaagcctatgccgtttatttggctatcctgaaatcaggaatggttgtcattccgtgctcc
gaaatgcttcgcgcgaaagatcttgaataccggattgaacatgcagaggtaaaaggcgcc
atcgtctactcagaatttattggcgctttccgggatgtcagtacggctgacaaactgatt
acactgtctattggtgaaaatgatgccggctggaaaaacctcttatcaattgaagcggac
ggaagccaatttaaaacagctgacacaacaagagatgatatggctttcttatcttataca
tccgggacaacaggtcagccgaaaggtgttgtacatacacatggatgggcatttgctcat
ttaaaaacttctgccggcgcttggcttgatatttctgaaaaggatatcgtctgggcaact
gctgcccctggctggcaaaagtgggtatggagtccgtttttagcggtgcttggcagcgga
gcaaccggttttgtgtaccacggcagattcaaagcagaaaaatatctagagcttttaaat
cgctacaaaatcaatgttttctgctgtacgccgacagaataccgcttaatggcgaaggtc
gagggcttggaccgctttgatctttctgccctgcacagcgctgtttccgcaggtgagccg
ctcaaccgtgaagtcattgatgttttccaaaagcactttggcattaaggtacgggacgga
tatggccaaactgaaagcacgcttttggttggtgttttgaaagatacgcctattaaaccg
ggaagcatgggaaaaccgacaccgggaaatcaggtggagatcataaatgaagacggtgaa
atctgcaaaactggtgaggttggcgatatcgctgttcacctcagtacgcctgcgatcttt
aaagagtattttaaagatccggaaagaatgaaaacacaaattcgcggcgattatttccta
acgggagacagagcaagaaaagatgaggaaggttacttctggtttgaaagccgaaatgac
gatattattatcagctccggctatacgatcgggcctttcgaggtggaagacgcgcttgtt
aagcacccagaagtaaaagaatgtgctgttgtcgcgagccctgatgaaatcagaggctcc
atcgtaaaggcatatgttgtcctgcaaaatcatgaaaaacgcagtgatgagcttgtcaaa
atgctgcaaaaccatgtgaagacgattaccgctccatacaaatatcctagagaaattgaa
tttgtggaaagcctgccgaaaacggcttctgcaaaaatcagacgagtggaattaagaaaa
cgtgaagaacagctcaaagccaataaaaaggcgtaa

DBGET integrated database retrieval system