KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_1111Help
Entry
A7A1_1111         CDS       T02384                                 

Definition
(GenBank) Inner spore coat protein H
  KO
K06330  spore coat protein H
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Brite
KEGG Orthology (KO) [BR:bsl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    A7A1_1111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CotH Ribosomal_L23eN
Motif
Other DBs
NCBI-ProteinID: AGA21729
LinkDB All DBs
Position
502953..504041
Genome map
AA seq 362 aa AA seqDB search
MKNQSNLPLYQLFVHPKDLRELKKDIWDDDPVPAVMKVNQKRLDIDIAYRGSHIRDFKKK
SYHISFYQPKTFRGAREIHLNAEYKDPSLMRNKLSLDFFSELGTLSPKAEFVFVKMNGKN
EGVYLELESVDEYYLAKRKLADGAIFYAVDDDANFSLMSDLERETKTSLELGYEKKTGTE
EDDFYLQDMIFKINTVPKAQFKSEVTKHVDVDKYLRWLAGIVFTSNYDGFVHNYALYRSG
ETGLFEVIPWDYDATWGRDIHGERMAADYVRIQGFNTLTARILDESEFRKSYKRLLEKTL
QSLFTIEYMEPKIMAMYERIRPFVLMDPYKKNDIERFDREPDVICEYIKNRSQYLKDHLS
IL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatcaatccaatttaccgctttatcagctgtttgttcatccaaaagacttgcgt
gaattaaaaaaggatatatgggacgatgatccggtgccagctgtgatgaaggtaaatcaa
aaaaggctggatattgatatcgcttatcggggatcacatatcagagacttcaaaaagaag
tcataccatatttccttttatcagccgaaaacattccgcggcgcgagagagattcactta
aatgcggagtataaagacccttccttgatgagaaacaaattgtctctggattttttctcg
gagctagggacactgtctccaaaggcagagtttgtgtttgtaaagatgaatgggaagaat
gaaggggtttatcttgaacttgaatccgtagatgaatattatttggcgaaaaggaagctg
gctgatggcgcgattttttatgcggtggatgatgatgccaacttttctctgatgagcgat
ttagaaagggaaacgaaaacatcgctggagcttggatatgaaaagaaaacagggactgag
gaggatgatttttatttacaggatatgatttttaaaattaatacggtccctaaagctcag
tttaagtcagaagtgacaaaacacgtggatgtcgacaagtatttgcgctggcttgccggt
attgtattcacctcgaactatgacgggtttgtccacaactacgcattatacagaagcggg
gaaaccggattatttgaggtgattccttgggattatgatgcgacttggggcagggatatc
catggagagcggatggctgccgattatgtaagaattcaaggatttaatacactaaccgcc
cggatattggatgaatccgagtttcgcaagtcctacaagcgcctgttagaaaaaacgctc
caatctctttttacaatagaatatatggaaccgaaaatcatggcgatgtatgaacggatt
aggccgtttgtcctcatggacccgtataaaaagaatgatattgagcgttttgaccgtgag
ccggatgtgatctgcgagtatattaaaaaccgttcacaatacctcaaagatcatttaagt
attttatga

DBGET integrated database retrieval system