KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_1502Help
Entry
A7A1_1502         CDS       T02384                                 

Definition
(GenBank) Transaminase MtnE
  KO
K08969  aminotransferase [EC:2.6.1.-]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
bsl00270  Cysteine and methionine metabolism
bsl01100  Metabolic pathways
Module
bsl_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bsl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    A7A1_1502
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsl01007]
    A7A1_1502
Enzymes [BR:bsl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     A7A1_1502
Amino acid related enzymes [BR:bsl01007]
 Aminotransferase (transaminase)
  Class I
   A7A1_1502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AGA22120
LinkDB All DBs
Position
complement(2643111..2644307)
Genome map
AA seq 398 aa AA seqDB search
MKFEQSHVLKELPKQFFASLVQKVNRKLAEGHDVINLGQGNPDQPTPEHIVEEMKRAVAD
PENHKYSSFRGSYRLKSAAAAFYKREYGIDLDPETEVAVLFGGKAGLVELPQCLLNPGDT
ILVPDPGYPDYWSGVTLAKAKMEMMPLVKDRAFLPDYSSITAEVREQAKLMYLNYPNNPT
GAVATSEFFEDTVRFAAENGICVVHDFAYGAVGFDGCKPLSFLQTEGAKDIGIEIYTLSK
TYNMAGWRVGFAVGNASVIEAINLYQDHMFVSLFRATQEAAAEALLADQTCVAEQNARYE
SRRNAWITACREIGWDVTAPAGSFFAWLPVPEGYTSEQFSDLLLEKANVAVAAGNGFGEY
GEGYVRVGLLTSEERLKEAAYRIGKLNLFTQKSIDKTL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgaacagtctcatgtattgaaggaattgcctaaacaattcttcgcttctctg
gtgcagaaagtgaaccgaaagctcgcagaaggacatgacgttatcaatctaggacaggga
aatccagatcagccgactcctgaacatattgttgaggagatgaaacgagctgttgctgat
cctgagaatcataaatattcttcttttcgcggctcataccgtctgaagtcagcggctgct
gcattttacaaaagagaatacggcattgatctggatccggaaaccgaagtcgctgtatta
ttcggcggaaaagcgggtctagtcgagctcccgcaatgcttgttgaatcccggtgatacg
attttagttcccgatccgggttatcctgattactggtcgggtgtcacacttgcaaaagca
aagatggaaatgatgccgctcgtaaaggacagggcgtttctccctgattacagcagcata
accgctgaagtaagggaacaggcgaaattgatgtatttgaattatccgaataatccgact
ggagctgttgctacttccgagttctttgaagataccgtgcgttttgcggctgaaaacgga
atctgcgtcgttcacgattttgcttacggcgctgtaggatttgacggctgcaagccttta
agctttttgcagactgaaggtgcgaaggatatcggaattgaaatttacacgctgtcaaaa
acgtataatatggcaggatggcgggttggctttgccgtcggaaacgcttcggtcattgaa
gcgatcaatctttatcaagaccatatgtttgtcagtcttttcagagcgactcaggaggct
gcagcagaggcactgttagccgatcagacgtgtgtggcagagcaaaatgccagatatgag
agcaggcgaaacgcttggatcacggcatgccgggaaatcggctgggatgtaacagctccc
gcaggttctttttttgcatggctgcctgtgcctgaaggctatacttctgagcagttctca
gatcttttgctggaaaaagcgaatgtggcggttgcggctggaaacggcttcggtgaatat
ggcgagggctacgtcagagtcggacttttaacaagtgaagaaagacttaaggaagccgct
tatcgaattggcaaactgaacctgtttacccaaaaaagcattgacaagaccttataa

DBGET integrated database retrieval system