KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_1778Help
Entry
A7A1_1778         CDS       T02384                                 

Definition
(GenBank) Hypothetical protein YfmT
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
bsl00627  Aminobenzoate degradation
bsl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsl00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    A7A1_1778
Enzymes [BR:bsl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     A7A1_1778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGA22396
LinkDB All DBs
Position
complement(3256328..3257794)
Genome map
AA seq 488 aa AA seqDB search
MLTMFQYEELNKQFIGGKWQEGSSPNVLENKNPYTQKTFTTFRKATADDVDEAYRAAALA
KKKWDAVNPFEKRTILEKAVTYIEENEEAIIYLIMEELGGTRLKAAFEIGLVKNIIKEAA
TFPVRMEGKILPSTIDGKENRLYRVPAGVVGVISPFNFPFFLSMKSVAPALGAGNGVVLK
PHEETPICGGTLIAKIFENAGIPAGLLNVVVTDIAEIGDSFVEHPVPRIISFTGSTKVGS
YIGQLAMKHFKKPLLELGGNSAFIVLEDADIEYAVNAAVFSRFTHQGQICMSANRVLVHS
SIYDKFLELYQAKVESLKVGDPMDPDTIIGPLINSRQTDGLMKTVEQAIEEGAVPVKLGG
FNGTIVEPTILKDVKPFMSIAKEELFGPVVSFMKFDSEDEAVDIANETPFGLSGAVHTSN
LERGVAFAKRIETGMIHVNDTTINDEPNVAFGGEKQSGLGRLNGEWSLEEFTTLKWISVQ
HEKRSFPY
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccatgtttcaatatgaagagttgaataaacagtttatcggcgggaaatggcag
gagggcagcagcccaaatgtattggaaaacaaaaatccttatactcaaaaaacattcaca
acattccgtaaagcgactgctgacgatgtagatgaagcgtacagggcagcggcgctggcg
aagaaaaaatgggatgcggtcaatccgttcgagaaaaggaccattttagaaaaagccgtc
acgtatatcgaagagaacgaagaagccatcatttatttgattatggaagagcttggcgga
acaaggctcaaagcagcttttgaaatcggtcttgtcaaaaacatcataaaagaagcggca
acgttccctgtccgcatggaaggcaaaattcttccgtccacaatagatggcaaggaaaac
agattatatcgcgtgccggcaggtgttgtcggtgtcatcagtccgtttaacttcccattc
tttttatctatgaaatcagtggcgcctgcactcggagccggcaatggcgttgtgctaaag
ccgcatgaggaaacgccgatttgcggcggaacgctgattgcgaaaatttttgagaacgcg
ggaattccagcggggctgctgaatgttgttgtcacagacattgctgaaatcggcgacagc
ttcgttgagcatccagtgccgaggatcatctcatttaccggttctacgaaagtcggcagc
tacatcggacagcttgcgatgaagcattttaaaaagccgcttcttgagcttggcgggaac
agtgccttcatcgtacttgaggatgcagatatagaatatgcggtcaatgcggcggtgttc
agccgatttacacatcaaggacagatttgcatgtcagccaaccgcgtgcttgttcattct
tctatttatgacaagttccttgagctgtaccaggcaaaagtggaatcgctgaaagtcggc
gacccaatggatcctgatacgattatcgggccattaatcaacagcagacagacggacggg
ctgatgaagactgtagagcaagcaattgaagaaggcgctgtaccagtgaagcttggcgga
tttaacgggacgatcgtggaaccgacgatcttaaaagacgtcaaaccgttcatgagcatt
gccaaggaagagctgttcggaccagtcgtctcctttatgaagtttgattcagaagacgag
gcggtggatatcgcaaacgaaaccccgtttggcttgagcggtgccgtacatacgtcaaat
cttgagcgcggcgtggcttttgcgaaacgcattgaaacgggcatgattcacgtcaatgac
acgaccatcaatgatgaaccgaatgtagccttcggcggtgaaaagcaatcaggcctcggc
cgtttaaacggtgagtggagcctcgaagaatttacaacgctgaaatggatctcggtccag
cacgaaaaacgcagcttcccttattaa

DBGET integrated database retrieval system