KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_2508Help
Entry
A7A1_2508         CDS       T02384                                 

Definition
(GenBank) Hypothetical protein YusQ
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tautomerase_2 Tautomerase DUF1007
Motif
Other DBs
NCBI-ProteinID: AGA23126
LinkDB All DBs
Position
849981..850364
Genome map
AA seq 127 aa AA seqDB search
MPFVQIHLRSGRSEAWLQKLSRTVHQSMIEEINVPEDDYFQVIRQYEKSEFFYDPFYLQV
ERTDELIYIHFTLKQSRTTEQKKALYRSIASRIHSELGVRKEDVFIMLAGNQAEDWSFGN
GRAQMIE
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgccatttgtacagattcatttacggtcgggaagaagcgaagcgtggcttcaaaaactg
agcaggactgtccaccaatcgatgattgaagaaatcaatgtgccggaagatgactatttt
caagtcatcagacaatatgaaaaaagcgaatttttttatgatccattttatctccaagtc
gagcgtactgatgaactgatatacattcattttacactgaaacagtcaagaacaactgaa
cagaaaaaagcactttaccgctcaatcgcgagccggattcattccgagcttggtgtcaga
aaagaagatgtgtttatcatgctggccggaaatcaggctgaggattggtctttcggaaat
ggaagagcccagatgattgaataa

DBGET integrated database retrieval system