KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_3094Help
Entry
A7A1_3094         CDS       T02384                                 

Definition
(GenBank) Multidrug resistance protein YcnB
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2
Motif
Other DBs
NCBI-ProteinID: AGA23712
LinkDB All DBs
Position
3603344..3604762
Genome map
AA seq 472 aa AA seqDB search
MNTSIEQKPFNRSVIVGILLAGAFVAILNQTLLITALPHIMRDFNVDANQAQWLTTSFML
TNGILIPITAFLIEKFTSRALLITAMSIFTAGTVVGAFAPNFPVLLTARIIQAAGAGIMM
PLMQTVFLTIFPIEKRGQAMGMVGLVISFAPAIGPTLSGWAVEAFSWRSLFYIILPFAVI
DLILASILMKNVTTLRKTQIDILSVILSTFGFGGLLYGFSSVGSYGWSSSTVLISLLVGV
IALLLFITRQMKLEKPMLEFRVFTFGFFSLTTLLGTLVFALLIGTETILPLYTQNVRDVT
AFDTGLMLLPGAVVMGFMSPIIGRIFDRVGGRGLAIAGFCIIFLTSLPFMQLTDHTSLAW
IVVLYTVRLLGTAMIMMPVTTAGINALPRHLIPHGTAMNNTIRQVGGSIGTALLVSVMSN
QAAHAGTTNVKHAALHGMNAAFIVAAVIALVGFLLSFTLKKPQRPAEQQPAR
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
ttgaacacaagtattgaacaaaaaccttttaaccgttctgtcattgtcggcattttgtta
gccggagcgtttgtggcgattttgaaccagacattgttgattaccgcacttccccatatc
atgagggatttcaatgtcgatgccaaccaagcacaatggctgaccacatcatttatgtta
accaacgggattttaattccgattaccgcgtttttaattgagaaattcacaagccgggcg
ctgctcatcacagcaatgagcattttcactgccggaacagtcgtcggagcgttcgcgccg
aacttcccggttctgctgacagcgcgtatcattcaagcggccggagccggcattatgatg
ccgctcatgcagactgtattcctgacaatctttccgattgaaaaacgcggccaggctatg
ggtatggtcggattggtcatctcattcgcgcctgcgatcggaccgactctttccggatgg
gctgtcgaagctttctcttggagatcattgttttatattattcttccgtttgctgtgatt
gatttgattcttgccagcatcctgatgaaaaacgtgacgactttaagaaaaacacagatt
gatattttatcagtcatcctttcaacatttgggttcggcggccttctgtacggcttctca
agcgtcggctcttacggctggtccagttcaaccgtcttgatttcactgctggtgggtgtc
atcgcgctgctcttgtttatcacaagacaaatgaagcttgaaaaaccgatgctggaattc
cgcgtcttcacgtttggctttttcagtttaacaacactgctgggaaccctcgtctttgca
ttattgatcggtacggaaaccatcctgccgctttatacacaaaatgtcagagacgtcaca
gcttttgatacagggcttatgctccttccgggagccgttgtgatgggctttatgtcgccg
attatcggcagaatttttgaccgtgtcggcggaagagggctggcgattgccggtttctgc
atcatcttcctgacatctctgccgtttatgcagctgactgaccatacgtcactcgcttgg
attgtcgttttatacaccgttcgtctcttaggcaccgccatgatcatgatgccggtgaca
acagccggaatcaatgcgctgccgcgccacttgattccgcacggaactgcgatgaacaac
acgattcgccaagtcggcggctcgatcggaaccgcactattggtttccgtgatgagcaac
caggcggcacatgcaggcacgacaaatgtgaagcacgccgccctgcacggcatgaacgcc
gcttttatagtggctgccgtcattgcacttgtcggcttccttctctcattcacattaaag
aaacctcagcgccctgccgaacagcagccggcacgctga

DBGET integrated database retrieval system