KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_3797Help
Entry
A7A1_3797         CDS       T02384                                 

Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
bsl00564  Glycerophospholipid metabolism
bsl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A7A1_3797
Enzymes [BR:bsl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A7A1_3797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 GIDA Pyr_redox_2 NAD_binding_8 FAD_oxidored 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AGA24415
LinkDB All DBs
Position
complement(3068785..3070449)
Genome map
AA seq 554 aa AA seqDB search
MKHQFSSLERDRMLTDMTKKTYDLFIIGGGITGAGTALDAASRGMKVALSEMQDFAAGTS
SRSTKLVHGGLRYLKQFEVKMVAEVGKERAIVYENGPHVTTPEWMLLPFHKGGTFGSFTT
SIGLRVYDFLAGVKKSERRSMLSAKETLQKEPLVKKDGLKGGGYYVEYRTDDARLTIEVM
KEAVKFGAEPVNYSKVKELLYEKGKAVGVLIEDVLTKKEYKVYAKKIVNATGPWVDQLRE
KDHSKNGKHLQHTKGIHLVFDQSVFPLKQAVYFDTPDGRMVFAIPREGKTYVGTTDTVYK
EALEHPRMTTEDRDYVIKSINYMFPELNITANDIESSWAGLRPLIHEEGKDPSEISRKDE
IWTSDSGLITIAGGKLTGYRKMAEHIVDLVRDRLKEEGEKDFGPCKTKNMPISGGHVGGS
KNLMSFVTAKTKEGIAAGLSEKDAKQLAIRYGSNVDRVFDRVEALKDEAAKRNIPVHILA
EAEYSIEEEMTATPADFFVRRTGRLFFDINWVRTYKDAVIDFMSERFQWGEQAKNKHTEN
LNKLLHDAVVPLEQ
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatcaattttcaagtcttgaaagagatcgcatgctgacagacatgacgaaaaaa
acatatgacctatttattatcggaggaggaattacaggagccggaacagctcttgacgcg
gcatcaaggggaatgaaggtcgcactaagcgaaatgcaggactttgcggcgggaacatca
agccgatcaacgaagctggtacatggcggcttgcgctatttaaaacaatttgaagtgaaa
atggtcgctgaggtaggaaaagagcgggcgattgtttatgaaaacggcccgcatgtcact
acaccggaatggatgctgcttccgtttcataaaggcggcacattcggttcatttacaaca
tcaatcgggttaagggtttatgacttccttgcaggtgtgaaaaagtcagaacgaagaagc
atgctttcagcaaaagaaacgctgcaaaaagagcctttggtaaaaaaagacggcttaaaa
ggcggcgggtactatgtggaataccgcactgacgatgcgagactgaccatcgaagtcatg
aaggaagcggtgaaattcggggcagagcctgtgaattactccaaagtgaaggagcttctt
tacgaaaaaggcaaagccgtcggcgtattaattgaagatgtgctgacaaagaaagaatat
aaagtgtatgcgaaaaaaattgtcaatgctacaggcccttgggtcgatcagctcagagaa
aaagaccattcgaaaaacggaaagcatttgcagcatacaaaaggcattcaccttgtattt
gaccagtctgtctttccgctgaaacaggctgtatatttcgatacacctgatggccggatg
gtatttgcgattcctcgtgaaggcaaaacatacgtgggaacaacagacactgtttacaaa
gaggcgctggagcatccgcggatgacaacggaggatcgtgattatgtcatcaaatcaatc
aattacatgttcccggaactgaatatcactgcgaatgacatcgaatccagctgggcgggg
ctgcgtccgctgattcatgaagaaggcaaagatccttctgaaatttcacggaaagacgag
atttggacatctgactcaggcctgatcaccattgccggcggaaaactgactggatacaga
aaaatggcggagcacatcgttgatcttgtccgtgatcgcttaaaagaagagggcgaaaag
gattttggaccatgtaaaacgaaaaacatgccaatctctggcgggcacgtcggcggttcg
aaaaatctcatgtccttcgttaccgcgaaaacaaaagaaggaattgcagccggtttatca
gaaaaagacgcaaaacagctggcaatcagatacggctctaacgtagatcgcgtctttgac
cgggtagaagcgctgaaagatgaggccgcgaaacgcaacattccggttcatattcttgct
gaggcagaatacagtatagaagaagagatgactgcaacccctgctgacttctttgtccgc
agaacgggacgtttattttttgatatcaattgggtaagaacatataaagatgccgttatt
gattttatgagcgagcgattccaatggggtgagcaggcgaaaaacaaacatacagaaaac
ctcaacaagcttttacacgatgcggtcgtaccgcttgagcaataa

DBGET integrated database retrieval system