KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_3820Help
Entry
A7A1_3820         CDS       T02384                                 

Definition
(GenBank) putative ABC transporter ATP-binding protein YhcG
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Brite
KEGG Orthology (KO) [BR:bsl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsl02000]
    A7A1_3820
Transporters [BR:bsl02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    A7A1_3820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA AAA_23 AAA_15 AAA_29 SMC_N AAA_5 AAA_22 G-alpha AAA_27 AAA_14 AAA_30 Zeta_toxin KdpD AAA_33 AAA_2 Mg_chelatase AAA_24 AAA_16 SbcCD_C Rad17 VirE FlbD RsgA_GTPase MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AGA24438
LinkDB All DBs
Position
complement(3093109..3093807)
Genome map
AA seq 232 aa AA seqDB search
MEIKLEHVSKKYGRHTAVNDVSITLSSGRIYGLIGPNGSGKSTTLKMMAGLLFPTSGFVK
VDEEQVTREMVRQTAYLTELDMFYPHFTVKDMVNFYQSQFPDFQTEQAYKLLNEMQLNPE
KKIKKLSKGNRGRLKIVLALARRADVILLDEPFSGLDPMVRDSIVNSLVSYIDFEQQIVV
IATHEIDEIETLLDEVIILANGEKVAQREVEDIREQEGMSVLQWFKSKMEVC
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcaagctagaacatgtatcaaaaaaatacggccgccatacggccgtcaatgat
gtgtcaatcaccctatcatccggacggatttatggcctgatcggaccgaacggcagcggc
aagtcaacgaccctgaaaatgatggctggccttctgtttccgacttcaggatttgtgaaa
gttgatgaagagcaggttacgagagaaatggtgcgtcaaacggcttatcttactgagctt
gatatgttttatccgcatttcactgttaaagatatggtgaatttttatcagtcgcagttt
cctgattttcaaacagaacaggcttataagctattgaatgagatgcagctgaatccggaa
aaaaagatcaaaaagctatcaaaaggaaatcggggccggctgaaaatcgttcttgcttta
gcgagacgggcagacgtcatcttgcttgatgaacctttttccgggcttgatccgatggtc
agggattccatcgtaaacagccttgtgtcgtacattgattttgagcagcagattgtcgtg
atcgcgacacatgaaattgatgaaattgagactttgttagatgaagtaatcatcctcgcc
aatggagaaaaagttgcgcagcgtgaagtagaagatattcgtgaacaggaaggcatgtct
gttttgcaatggtttaaatcaaaaatggaagtttgctag

DBGET integrated database retrieval system