KEGG   Bacillus smithii: BSM4216_0137Help
Entry
BSM4216_0137      CDS       T03984                                 

Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bsm  Bacillus smithii
Brite
Translation factors [BR:bsm03012]
 Eukaryotic Type
  Elongation factors
   BSM4216_0137
 Prokaryotic Type
   BSM4216_0137
Mitochondrial biogenesis [BR:bsm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BSM4216_0137
Exosome [BR:bsm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BSM4216_0137
  Exosomal proteins of breast cancer cells
   BSM4216_0137
  Exosomal proteins of colorectal cancer cells
   BSM4216_0137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AKP45520
UniProt: A0A0H4NXX6
LinkDB All DBs
Position
1:136176..137363
Genome map
AA seq 395 aa AA seqDB search
MGKAKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLAKQGKAEARAYDQIDGAPEERERG
ITISTAHVEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYEFPGDDIPVIKGSALKALE
GDPEWESKIIELMDAVDEYIPTPEREVDKPFMMPVEDVFSITGRGTVATGRVERGQLKIG
DEVEIIGLSDELKKTTVTGVEMFRKILDYAEAGDNIGALLRGISREEVQRGQVLAKPGTI
TPHTKFKAQVYVLSKEEGGRHTPFFSNYRPQFYFRTTDVTGIITLPEGVEMVMPGDNVEM
TVELIAPIAIEEGTKFSIREGGRTVGAGSVSSVIE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagcaaaatacgatcgctcaaaaccacacgttaatattggtacaatcggtcac
gttgaccatggtaaaacaactttgactgctgctattaccactgttcttgctaaacaaggt
aaagcagaagctcgcgcatatgatcaaatcgacggtgctcctgaagaacgtgaacgcggt
attactatttctactgcacacgttgaatatgaaacagacaaacgccactatgcgcacgtt
gactgtccaggacatgctgactatgttaaaaacatgatcactggtgcagcacaaatggat
ggagctatccttgttgtatctgcagctgatggtcctatgcctcaaactcgcgaacacatt
cttctttctcgtcaagtaggtgttccttacatcgttgtattcttaaataaatgcgacatg
gttgacgacgaagaattacttgaattagttgaaatggaagttcgcgatcttctttctgaa
tatgaattccctggtgacgacattcctgtcatcaaaggatctgctcttaaagctttagaa
ggagatcctgaatgggaaagcaaaattattgaattaatggatgcagtagacgaatacatc
ccaactccagaacgtgaagttgacaaaccgttcatgatgccagtagaagacgtgttctct
atcactggacgcggtactgttgcaactggtcgtgtagaacgcggtcaattgaaaatcgga
gacgaagtagaaattatcggtttatctgatgaacttaagaaaacgactgttactggggtt
gaaatgttccgtaaaattcttgactatgcagaagctggtgacaacatcggtgcccttctt
cgtggtatttcccgtgaagaagttcaacgcggtcaagtattagcaaaaccaggaaccatt
actcctcatacaaaatttaaagcgcaagtatatgttttgtctaaagaagaaggtggacgt
catactccattcttctcaaactatcgccctcaattctatttccgtactactgacgtaacg
ggaattatcactcttccagaaggcgtagaaatggttatgcctggtgataacgttgaaatg
acagtagaattgattgcgccaatcgctattgaagaaggaacaaaattctctatccgtgaa
ggcggacgtacagtaggcgctggttctgtatctagtgtcattgaataa

DBGET integrated database retrieval system