KEGG   Bacillus smithii: BSM4216_0414Help
Entry
BSM4216_0414      CDS       T03984                                 

Definition
(GenBank) Glycerol kinase
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
bsm  Bacillus smithii
Pathway
bsm00561  Glycerolipid metabolism
bsm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BSM4216_0414
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsm04147]
    BSM4216_0414
Enzymes [BR:bsm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BSM4216_0414
Exosome [BR:bsm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSM4216_0414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AKP45762
UniProt: A0A0H4PD42
LinkDB All DBs
Position
1:362947..364440
Genome map
AA seq 497 aa AA seqDB search
MEKYILALDQGTTSSRAILFDKEGKIVHTAQREFHQLFPQPGWVEHNPNEIWGSILACIA
AVLSEAGIEANQVAGIGITNQRETTVVWEKDTGKPIYNAIVWQSRQTADICEQLKEKGYN
ELFHKKTGLLIDPYFSGTKIKWILDHVEGARERAKKGELLFGTIDTWLIWKLSGGKAHVT
DYSNASRTLLYNIHELKWDEELLEILDVPKEMLPEVRPSSEVYAKTVSYHFFGEEVPIAG
AAGDQQAALFGQACFEEGMAKNTYGTGCFMLMNTGDKAVESKHGLLTTIAWGIDNKVEYA
LEGSIFVAGSAIQWLRDGLRMLKSAPESESYATRVESTEGVYVVPAFVGLGTPYWDSDVR
GAVFGLTRGTSKEHFIRATLESLAYQTKDVLTSMEADSGIFLKTLRVDGGAVMNNFLMQF
QSDILNVPVERPIINETTALGAAYLAGLAVGFWKDRQEISSQWKQDRQFSPTMAQETRET
LYNGWKKAIEAAQAFKW
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtacattttagcattagatcaaggaacgactagttccagagcgattttattc
gataaagaagggaaaattgtccatacggcgcagagagagttccatcaactgtttccgcag
ccgggctgggtcgagcataatcctaatgaaatatggggttctattcttgcttgcatcgca
gccgtactctccgaagcagggattgaggcaaatcaagtagcggggattgggatcaccaac
caacgggaaacgacggtcgtttgggagaaggataccggaaaaccgatctacaatgctatt
gtatggcagtcaaggcaaacagctgacatatgcgaacaattaaaggaaaaagggtataat
gagctgtttcataaaaaaacgggattattgattgatccgtatttttccggaacaaaaatc
aaatggatattagatcatgtggaaggtgcgcgcgaacgggcgaaaaagggagagttgctg
tttggaacgattgacacttggctgatttggaaactatccggcggaaaagcccatgtgacg
gactattcgaatgcttcccgcacgttgctttacaacatccatgagctgaagtgggatgaa
gagctgttggaaattctggacgtgccgaaagaaatgctgccggaagtccgaccgtcatcg
gaagtttatgccaaaacggtttcttatcatttttttggcgaggaagtgccgattgccggg
gctgccggggaccagcaggcagcgctgttcggtcaggcatgctttgaagaagggatggcg
aaaaacacgtatggaaccggctgttttatgctcatgaatacaggcgataaagcggtagaa
tcgaaacatggtttgttgacgaccattgcctgggggatcgacaataaagtcgaatatgcg
ctggaaggcagtatttttgtagccggttcggccattcaatggcttcgggatggattgaga
atgttaaaaagtgctccggaaagcgaaagttatgcgactcgtgtggaatcaacggaagga
gtttatgtcgtaccggcttttgtgggtctcggaacgccctattgggacagcgatgtccgg
ggggctgtcttcgggttgacacgaggtacgtccaaagagcattttattcgggccacgctg
gaatcgctggcttaccaaacaaaagatgtactgacttccatggaagcagattcgggaatc
ttcctgaaaacgctcagagtcgacgggggagcagtcatgaataactttttgatgcagttc
caaagcgatatccttaatgtacctgtcgaacggccgattattaatgaaacaacagcctta
ggagctgcttatctggctgggcttgctgttggcttttggaaagatcgccaagaaatatct
tctcaatggaaacaggatcggcaattctcgccgacaatggctcaagagacgcgtgaaaca
ttgtacaacggttggaaaaaagcgattgaagcggcacaggcttttaaatggtaa

DBGET integrated database retrieval system