KEGG   Bacillus smithii: BSM4216_0415Help
Entry
BSM4216_0415      CDS       T03984                                 

Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bsm  Bacillus smithii
Pathway
bsm00564  Glycerophospholipid metabolism
bsm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSM4216_0415
Enzymes [BR:bsm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BSM4216_0415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 GIDA FAD_binding_3 Pyr_redox NAD_binding_8 GMC_oxred_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AKP45763
UniProt: A0A0H4P019
LinkDB All DBs
Position
1:364584..366257
Genome map
AA seq 557 aa AA seqDB search
MIFSSENRDEVIEKMKTDTFDLLVIGGGITGCGIALDAAARGMKTALVEMQDFAAGTSSR
STKLVHGGLRYLKQLEVKMVAEVGKERAIVYENGPHVTTPEWMLLPFHKGGTFGAFTTSI
GLRVYDFLAGVKKSERRTMLSAEETLRKEPLIKKEGLKGGGYYVEYRTDDARLTIEVAKK
AVENGACLLNYVKAEQFLYSGKKMIGARVKDCVTGESFEIRAKKVVNAAGPWVDEVRKKD
HSMNGKHLRLTKGVHIVIDQSVFPLRQAVYFDTPDGRMVFAIPRAGKTYVGTTDTFYDGD
ARYPKPLKKDWEYLLNAIHFMFPDVQVNEKDIESSWAGVRPLIYEEGKDPSEISRKDEVW
EGDSGLITIAGGKLTGYRKMAETVVDLVAKELASEEGKTFKPCQTRYLPISGGDVGGSDN
WPIFVAQMAKKATQYGLKEEEGRRLAQLYGSNVEILYKIASEYQKASGEKLLPAAIYAQL
LYAIRYEMAVKPVDFFIRRTGSVFFDIKWAKKWKEPIVATMAEIFHWDEETKESYMEELE
KEITDAERPVDATDIHS
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgattttttcctcagaaaatcgtgacgaagtgatagagaagatgaaaacagatacattt
gatttgctagtgattggcggcggaattaccggctgcgggattgctttggatgctgccgca
aggggaatgaaaacggcattggtcgaaatgcaggatttcgcagcaggaacgtcaagccgt
tctaccaaactcgtgcacggcggtttgcggtatttaaaacaattggaagtaaaaatggtg
gccgaggtcgggaaagaacgggcgatcgtctacgaaaacgggccgcacgtgacgacaccg
gaatggatgcttcttccttttcataaaggcgggacgttcggtgcgtttacgacaagcatt
gggctgcgtgtttatgatttcttggcaggggtcaaaaaatcggaaagaaggacgatgctt
tccgctgaggaaaccttgcgcaaggaacctctcattaagaaagaaggcttaaaaggcggt
ggatattatgttgaatatcgcacggacgacgcccggctcaccattgaggtagcgaaaaaa
gcagtggagaacggcgcttgcttgctgaattatgtcaaagcggaacagtttttatacagc
ggcaaaaaaatgattggtgcccgcgtaaaagattgtgttacaggagaaagttttgaaatt
cgtgccaaaaaagtggtcaatgccgccgggccgtgggtggatgaagtgcgaaaaaaagac
cattcgatgaatggtaaacatttgcgtttgacaaagggagttcatattgtcatcgatcaa
tctgtattcccgctaaggcaggcggtatacttcgacacccctgatggtcgaatggtgttt
gctattccacgagcagggaaaacgtatgttggtacaaccgatacgttttatgacggcgat
gctcgctatcctaaaccgcttaaaaaagactgggaatatttgttgaacgctattcatttt
atgtttccggatgtccaagtaaacgaaaaagatattgaatccagctgggcaggagtaagg
ccgcttatatacgaggaagggaaagacccttcggaaatttcccgcaaagacgaagtatgg
gaaggagacagcggcctgattaccatcgccggtggaaaattgaccggataccgcaaaatg
gcggaaaccgtggtagatcttgtggcaaaagaattagcgtcagaagaaggaaaaacgttt
aagccttgccaaacccgctatttgccgatttccggaggtgatgtcggcggatcggacaac
tggccgattttcgtggcgcaaatggcaaaaaaagcgacgcagtatggcttgaaagaagag
gaaggccgcagactggcacagctgtacggttccaatgtcgaaattttatataagatagcc
agtgaatatcaaaaagcatccggtgaaaagctgctgccggctgctatatacgctcagctc
ctgtatgccatccgttatgaaatggctgtaaaacctgtcgacttttttattcgaaggact
ggatctgttttctttgatataaaatgggcaaaaaaatggaaagaaccaattgtagcgacg
atggccgaaatttttcattgggatgaagaaacgaaagaatcttatatggaagaattggaa
aaagaaatcaccgatgccgaaagaccggtggatgcaacggacatacacagttaa

DBGET integrated database retrieval system