KEGG   Bacillus smithii: BSM4216_1532Help
Entry
BSM4216_1532      CDS       T03984                                 

Definition
(GenBank) Serine/threonine protein kinase PrkCregulator of stationary phase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bsm  Bacillus smithii
Brite
KEGG Orthology (KO) [BR:bsm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsm01001]
    BSM4216_1532
Enzymes [BR:bsm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BSM4216_1532
Protein kinases [BR:bsm01001]
 Serine/threonine kinases: Other
  Bacterial family
   BSM4216_1532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kdo Kinase-like Haspin_kinase Seadorna_VP7 GDYXXLXY Castor_Poll_mid FTA2 RIO1
Motif
Other DBs
NCBI-ProteinID: AKP46813
UniProt: A0A0H4P2Z2
LinkDB All DBs
Position
1:1330772..1332733
Genome map
AA seq 653 aa AA seqDB search
MIGMLAGRRISGRYKVIEMIGGGGMAHVYLARDIILDRDVALKVLRMDFAEEEEFIRRFQ
REAQSATSLVHPNIVNIYDVGEEDNIFYIVMEYVDGMTLKQYIMQHSPIPVEKVLDIMSQ
LTSAIAHAHRNSIIHRDIKPQNILIDHNGHVKITDFGIAMALSATSITQTNSFLGSVHYI
SPEQARGGVATKKSDIYSLGIVMYELLTGNLPFSGETAISIALKHLQSNTPSLREKFPEI
PQSVENIVLKATCKDPFYRYNSVEEMEEDIRTALEPSRLNEPKFTILVDEEETKVIPAIK
GPLPVDDLESTAVYPLKEETNSGSDKPEKKKRKKWPWIVIGIFLLLLLAAGSVFVIPDLL
GPKEIKVPDVHGKTVDDAVSKLVTDGLKVGDTIERFSDHVPAGKVIYTKPGANQTVKEGS
SVDLYVSSGKKTFKLDDYRDRDYNEIADMLEKEHFKRIRKVEIYDDHPPGTIIDQDPGPN
EKVVPEETEMTFTVSRGPEKVSLIDLTDYNEKSLKDYAATSGLKVDIVRRDYSDSVPEGL
VISQNPSAGTLLNKGDRVEVVLSKGKKEIPPKTVTKELFIPYEPDEEGKPQEVVIYIEDA
NNSMTVPYETFFIHEDTRKTISLTIASGKKAGYKVVRDKKVIIDEMVPFPDDE
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggaatgcttgccggcaggagaatcagcggaagatacaaagtaatcgaaatgatt
ggcggaggcgggatggcgcatgtctatttagcacgagatatcatattggaccgagatgtg
gctctaaaagtattgagaatggattttgccgaagaagaagaatttatacgccgttttcaa
agagaagctcaatcggcaaccagtcttgttcacccgaatatcgtgaatatttatgatgtg
ggagaagaagacaatattttttacattgtgatggaatatgtggatggaatgactttaaaa
caatacataatgcagcattcccctatcccggtggagaaagtgctagacatcatgagtcag
ctgacttctgctatcgcccatgcacaccgcaattcgattattcaccgtgatattaaaccg
cagaatattttgatcgatcacaatggtcatgtcaaaattaccgattttggcattgcgatg
gctttaagtgcgacgtcgattacccaaaccaactcttttctcggatctgtgcattacatc
tctcctgaacaagctcgaggaggagtagcaacaaaaaaatcagacatttactctcttggt
attgtaatgtacgaactgctgacaggaaatttgccattttcaggagaaacagctatttcc
atcgccttaaaacatttgcaatccaataccccctctttgcgggaaaaatttccggaaatt
ccgcaaagtgtggaaaatattgtgctgaaagctacttgcaaagaccctttttaccgttat
aacagcgtggaagaaatggaagaagatataaggactgctcttgaaccgagccgactgaat
gaaccgaaatttaccattttggtggacgaagaagaaacaaaagtcatacctgccattaaa
ggtccacttccggtagatgatttagaatcgacggctgtttacccattaaaagaagaaacg
aacagtgggtcggacaagccggaaaaaaagaaaagaaaaaaatggccttggattgtaatc
ggaattttcttgctcttgttgttggcagcggggagcgtctttgtgatcccggatttattg
ggaccgaaagaaatcaaggtgccggatgttcatgggaaaacggtggatgacgccgtttcg
aaattggtgacggatggattgaaagttggagacacgatcgaaaggtttagcgatcatgta
ccggcaggaaaggtcatctataccaaacctggtgctaatcaaacagtaaaagagggatct
tctgttgatctgtatgtaagctccgggaaaaaaacatttaaactggatgattatcgtgat
cgggattataatgaaatcgccgacatgttggaaaaagaacattttaaaaggatccgtaaa
gtagagatatatgacgatcacccgccgggaaccatcatagaccaagatccggggccaaat
gaaaaagtcgttccggaagaaacagagatgacatttacggtaagcaggggtccggaaaag
gtatcgctgattgatttgactgattacaacgagaaaagtttgaaagattatgcggccaca
agcggtttaaaagtggacattgtcagaagagattattctgacagtgtgccggaagggctg
gtaatctctcaaaatccttcagccggtacgctgttaaacaaaggggatagagtggaagtt
gtgctgtcaaaaggcaaaaaagaaattccgcctaaaaccgttacaaaagaattgttcatt
ccatatgaaccggatgaagaaggaaagcctcaagaagtggtcatttacatcgaagacgca
aacaacagcatgactgtaccatatgagacttttttcattcatgaagacacgagaaaaacg
atttcattgacgattgccagtggcaaaaaagcaggatataaagtggttagagataaaaaa
gtcatcattgacgaaatggtcccttttccggatgacgagtaa

DBGET integrated database retrieval system