KEGG   Bacillus smithii: BSM4216_2708Help
Entry
BSM4216_2708      CDS       T03984                                 

Definition
(GenBank) hypothetical protein
Organism
bsm  Bacillus smithii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3792 Peptidase_U4 DUF5518 7TMR-DISM_7TM
Motif
Other DBs
NCBI-ProteinID: AKP47943
UniProt: A0A0H4P632
LinkDB All DBs
Position
1:2360102..2360485
Genome map
AA seq 127 aa AA seqDB search
MQRQISAVLYGVIAILIMAIASSLIFATILRLSQLTEHSIQLLVTIISFFSLFIGGYITG
GKGKEKGLLLGAFTGIIYSSIIFLYQFLGYDSIFSLKQLIFHLCYIATAMLGSVLGVNLS
GGKTKES
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaggcaaattagtgcagtgttatacggagtcatcgcgatcctgatcatggccata
gccagcagccttatttttgctacgattttacggttatcgcaattaacggaacattccatt
caattattggtcaccattatatcttttttcagtttatttatcggggggtacatcacgggg
ggaaaagggaaagaaaaaggactgcttctcggagcatttacaggaatcatttatagttcc
attatttttctatatcagtttctcggatacgactccatcttttctttaaagcaactcatc
ttccatctttgctatatcgccaccgccatgctaggaagcgtattgggcgtcaatctttcc
ggcgggaaaacgaaagagtcttag

DBGET integrated database retrieval system