KEGG   Bacillus smithii: BSM4216_2709Help
Entry
BSM4216_2709      CDS       T03984                                 

Definition
(GenBank) Preprotein translocase subunit YajC TC 3.A.5.1.1
  KO
K03210  preprotein translocase subunit YajC
Organism
bsm  Bacillus smithii
Pathway
bsm02024  Quorum sensing
bsm03060  Protein export
bsm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bsm00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BSM4216_2709
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BSM4216_2709
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSM4216_2709
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsm02044]
    BSM4216_2709
Secretion system [BR:bsm02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   BSM4216_2709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YajC Orf78 PDZ_4
Motif
Other DBs
NCBI-ProteinID: AKP47944
UniProt: A0A0H4P291
LinkDB All DBs
Position
1:complement(2360567..2360866)
Genome map
AA seq 99 aa AA seqDB search
MGSLGTFLPLIIMFVLFYFLLIRPQQKRQKQVMNMQNSLEKGDKIVTIGGLHGIVDSLDE
NTIVIRCGDGSRLTYDRSAVRDVIEKAKSSSTNSSSTNS
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
ttgggtagtttaggaacatttttgcctttaattatcatgttcgttctgttttacttcttg
cttatccgtcctcagcaaaaacggcaaaagcaagtcatgaatatgcagaacagcttggaa
aaaggagataagatcgttacgattggcggtcttcatggcatcgtcgattcgctggatgaa
aatacgattgtcattcgatgcggagatggcagccgtttgacatacgaccggtcagcggtt
cgtgatgtgattgaaaaagccaaaagttcttcgacgaactcgtcttcaacaaactcgtaa

DBGET integrated database retrieval system