KEGG   Bacillus smithii: BSM4216_2851Help
Entry
BSM4216_2851      CDS       T03984                                 

Definition
(GenBank) Isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bsm  Bacillus smithii
Pathway
bsm00020  Citrate cycle (TCA cycle)
bsm00480  Glutathione metabolism
bsm01100  Metabolic pathways
bsm01110  Biosynthesis of secondary metabolites
bsm01120  Microbial metabolism in diverse environments
bsm01130  Biosynthesis of antibiotics
bsm01200  Carbon metabolism
bsm01210  2-Oxocarboxylic acid metabolism
bsm01230  Biosynthesis of amino acids
Module
bsm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsm_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bsm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSM4216_2851
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BSM4216_2851
Enzymes [BR:bsm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BSM4216_2851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AKP48085
UniProt: A0A0H4P580
LinkDB All DBs
Position
1:complement(2490433..2491704)
Genome map
AA seq 423 aa AA seqDB search
MSQGEKITVQNGVLKVPNNPIIPFIEGDGTGPDIWRAASRVLDAAVEKAYKGERKIVWKE
VYAGEKAFNKTGEWLPQETLDVIREYLIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFEGVPSPVKRPQDTDMVIFRENTEDIYAGIEYQKGTPEVKKVIDFLQNEMGVKKIR
FPETSGIGIKPVSEEGSKRLIRAAINYAIKEGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EEEFGDKVFTWAQYDRIKEEQGTEAANKAQQEAEAAGKIIVKDAIADIFLQQILTRPREF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYANLDKVNPS
SVILSGVLMLEHLGWNEAANLIVKSMEKTIASKVVTYDFARLMEGAKEVKTSEFGSQLIA
NME
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaggggaaaaaatcacagtacagaacggagttttaaaagtacctaataatccg
attattccatttattgaaggggacggaacaggccctgatatttggagagcagcttcacgc
gttttagatgcggcggtggaaaaagcttataaaggcgaaagaaaaatcgtttggaaagaa
gtatatgccggcgaaaaagctttcaataaaacaggtgaatggcttccgcaagaaacattg
gatgtcatccgagaatatctcattgcgattaaagggcctttaacaactccggtaggcggt
ggaattcgttctttaaatgttgctttacgacaagaactcgatctttttgtgtgcctgcgt
ccagtacgttattttgaaggagtaccttcaccggtaaaacgcccgcaagataccgatatg
gtcattttccgtgaaaatacggaagatatttacgctggaattgaatatcaaaaaggcact
cctgaagtgaaaaaagtcattgattttcttcaaaatgaaatgggcgtcaaaaaaatccgc
ttcccagaaacttctggaatcggcattaaaccggtttcggaagaaggatctaagcgtctt
ataagagcggctattaactatgcaattaaagaaggcagaaaatctgttacattagtacat
aaaggaaatattatgaagtttacagaaggtgccttcaaaaattggggatacgaattggcg
gaagaagaattcggcgataaagtattcacgtgggctcaatatgaccgcatcaaagaagaa
caaggaacagaagctgccaataaagctcaacaagaggcagaagcagccggaaaaattatt
gtaaaagatgcgattgcggatattttcttgcaacaaattttaacacgtccgcgtgaattt
gatgtagtggccactatgaatttaaatggagactacatttctgatgctcttgctgctcaa
gtaggcggaatcggtattgctccaggggctaatattaactatgaaactggacatgctatt
tttgaagcaacacatggtacggctccaaaatatgctaatttggacaaggtgaatccatca
tccgttattttgtccggcgtattaatgcttgaacatttaggttggaatgaagcggccaac
ttaattgtcaaatcgatggaaaagaccattgcttccaaagtggtcacatatgattttgcg
cgcttgatggaaggggctaaagaagtcaaaacatccgaatttgggtcacaattaattgcg
aatatggaataa

DBGET integrated database retrieval system