KEGG   Bacillus smithii: BSM4216_3408Help
Entry
BSM4216_3408      CDS       T03984                                 

Definition
(GenBank) Glutamyl-tRNA Glnamidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bsm  Bacillus smithii
Pathway
bsm00970  Aminoacyl-tRNA biosynthesis
bsm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSM4216_3408
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bsm03029]
    BSM4216_3408
Enzymes [BR:bsm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BSM4216_3408
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BSM4216_3408
Mitochondrial biogenesis [BR:bsm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BSM4216_3408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AKP48586
UniProt: A0A0H4P379
LinkDB All DBs
Position
1:complement(2974626..2976086)
Genome map
AA seq 486 aa AA seqDB search
MALFDHKLTELHDLLHNKEVSVSDLVDEAYKRISETDEKIQAFLTLDEENARKKAQKLDE
KLSSDEEKGLLFGMPIGIKDNIVTKGLRTTCASKILENFDPIYDATVIEKLREAEAITIG
KLNMDEFAMGSSTENSGFQLTRNPWDTERVPGGSSGGSAAAVAAGQVPFALGSDTGGSIR
QPAAFCGVVGLKPTYGRVSRFGLVAFASSLDQIGPITRNVEDNAYLLQVIAGLDPHDSTS
ANVEVPNYAAALTGDVKGLKIAVPKEYLGEGVQEEVRQSVLNALKVLEKLGATWEEVSLP
HSKYGVATYYLLASSEASSNLARFDGIRYGYRTENAENLIELYKKTRAEGFGDEVKRRIM
LGTFALSSGYYDAYYKKAQQVRTLIKKDFEDIFETYDVIIGPTTPTPAFKIGENIDDPLT
MYANDILTIPVNLAGVPGISVPCGFSADGLPLGLQIIGKHFDESTVYRVAHAFEQATDFH
KQKPQL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggcactgtttgaccataagctgacagaattgcacgatcttttacataacaaagaagta
agcgtctcggacttagtcgatgaagcttataaaagaatcagtgaaacggatgaaaaaata
caagctttcttaactttagatgaagaaaacgctcgtaaaaaagcgcaaaaactggacgaa
aagcttagcagcgacgaagaaaaaggccttttattcggaatgccgattggaattaaagac
aacatcgttacaaaaggtctgcgcacaacttgcgccagcaaaatattagaaaacttcgat
cctatttatgatgcgaccgtaatcgaaaaacttcgggaagcagaagccattacgatcgga
aaattgaatatggatgaatttgcgatgggatcctccactgaaaattccggcttccagctg
actcgcaacccatgggatacggaacgtgttccgggcggttcttcaggaggctcggctgcg
gcagtggcagcgggacaagttccttttgctttaggatctgacacgggtggatcgattcgc
cagcctgcagccttttgcggagtcgtaggattaaagccgacctatggacgggtttctcgt
tttggattagtagcttttgcttcttctttggatcaaatcggtcccattacacgcaatgta
gaagataacgcttatcttctacaagtgatcgccggattggatccgcatgactctacatcg
gccaatgtggaagtgccgaattatgcggctgcactaaccggagatgtgaagggattaaag
atcgccgttccaaaagagtatcttggcgaaggagttcaagaagaagttcgacaatccgta
ttgaatgctttgaaagtgctcgaaaaactaggagccacttgggaagaagtatcgctcccg
cattcaaaatacggagtagccacgtactatctgttggcttcttctgaagcatcgtccaat
ttggctcgctttgacggcatccgctacggttatcggacggaaaatgccgaaaacttgatt
gaactttataagaaaacgagagcagaaggcttcggcgacgaagtaaagcgccgcattatg
cttggaacatttgcgttaagctccggttactatgatgcttattacaagaaggcacaacaa
gtgcgtacgctgatcaaaaaagactttgaagatatttttgaaacttatgatgtcatcatc
gggccaacgactccgacaccggcattcaaaatcggcgaaaatatagacgatccgttgacg
atgtatgcaaatgatattttaacgatccctgtgaatcttgcaggtgtgccgggaatctct
gttccatgcggattttctgcggacggattgccgttagggcttcaaattatcggaaagcac
tttgacgaaagcaccgtttaccgcgtggcgcatgcatttgaacaggcaacggacttccat
aaacaaaaaccgcaactgtaa

DBGET integrated database retrieval system