KEGG   Bacillus smithii: BSM4216_3518Help
Entry
BSM4216_3518      CDS       T03984                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bsm  Bacillus smithii
Pathway
bsm00473  D-Alanine metabolism
bsm01100  Metabolic pathways
bsm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bsm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSM4216_3518
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BSM4216_3518
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsm01011]
    BSM4216_3518
Enzymes [BR:bsm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BSM4216_3518
Peptidoglycan biosynthesis and degradation proteins [BR:bsm01011]
 Precursor biosynthesis
  Racemase
   BSM4216_3518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AKP48678
UniProt: A0A0H4P8C3
LinkDB All DBs
Position
1:complement(3070654..3071829)
Genome map
AA seq 391 aa AA seqDB search
MDTSQFYRDTWVEINLDHIAYNVKEALQLLPSTTDLFAVVKANAYGHGDVQVANTAIKAG
AKGLAVAFLDEALKLRNSGIEVPILVLGASRPEDAKLAADHRISLTVFQEEWLERAEPFL
NGSSLSVHMKVDTGMGRIGVRTEKELKALEKRIMRSPAFRLEGIFTHFATADEVDTDYFR
KQFEKFQVMVQLLEQKPKYIHCANSAATLRFKETSHAFNLVRYGISMYGLSPSADIQSLL
PFELKPALSLHTKIVHVKKVKKGERISYGGVYEAKEDEWIATLPIGYADGWIRKLQGQEV
LVGGKRAPIVGRICMDQCMIRLDEEVPVGTEVVLIGKQGRDEITMDEIAANLETIHYEIG
CMISHRVPRVYIESGKIVDVSNPLLSSHRKM
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtggatacatctcagttttacagggatacatgggttgaaattaatttggatcacattgct
tataatgtaaaagaagctttgcaacttttgccgtctacaacggatttatttgctgtggta
aaagccaatgcatacggtcacggtgatgttcaagttgccaacaccgctataaaggcggga
gccaaaggtttggctgtggcctttttagatgaagctttgaaattaaggaacagcggaatc
gaagtgccgattttagtattaggagcttccaggccggaagacgccaagttggcagcagac
catcgtatttcgttgacggtgtttcaggaagaatggttggaaagagcggaaccatttttg
aatggctcctcgttaagtgtgcatatgaaagtagatacgggaatgggccgaatcggtgta
aggaccgaaaaagagttgaaagcattggaaaaacgaattatgcgttcccctgcctttcga
ttagaagggatttttactcattttgcgacagccgacgaagtagatacagattatttccgg
aaacaatttgaaaaatttcaagtgatggtgcaacttctggaacaaaaaccaaaatatatt
cattgcgcgaatagtgcagctactttaaggtttaaagaaacatctcatgcttttaatctc
gttcgctatggaatttcgatgtatgggctgtcgccttctgccgacatccaatcccttctt
ccttttgaattaaaaccggcattatctctgcatacaaaaattgttcatgtgaaaaaggtg
aagaagggagaaagaatcagctacgggggtgtatatgaagcaaaggaagatgaatggatc
gctactttgccaatcggctatgcagacggctggattcgcaagcttcaaggccaagaagtg
ctggttggcgggaaaagagctcctatcgtaggacgaatttgcatggatcaatgcatgatc
cgcttagatgaggaagtgcccgtaggaacggaagtcgttttgatcggtaagcaaggccgg
gatgaaatcacgatggatgaaattgcggcaaatcttgaaacgattcattatgaaattggt
tgtatgatttcccatcgagttccccgtgtctatatagaatccggaaagattgtggacgtt
tcaaacccacttttgtcttctcaccggaaaatgtaa

DBGET integrated database retrieval system