KEGG   Bacillus smithii: BSM4216_3527Help
Entry
BSM4216_3527      CDS       T03984                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bsm  Bacillus smithii
Pathway
bsm00473  D-Alanine metabolism
bsm00550  Peptidoglycan biosynthesis
bsm01100  Metabolic pathways
bsm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bsm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSM4216_3527
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSM4216_3527
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BSM4216_3527
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsm01011]
    BSM4216_3527
Enzymes [BR:bsm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BSM4216_3527
Peptidoglycan biosynthesis and degradation proteins [BR:bsm01011]
 Precursor biosynthesis
  Amino acid ligase
   BSM4216_3527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST DUF3213 ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AKP48687
UniProt: A0A0H4PL27
LinkDB All DBs
Position
1:complement(3079658..3080722)
Genome map
AA seq 354 aa AA seqDB search
MKTKVCLLYGGKSAEHEVSLQTAKAVTEALDLEKFDVYPVHINKEGQWIKGPKLERPAES
VEDLQFSPQNQESTHPLAAFLEGGEEFDVVFPLLHGPNGEDGTVQGMLELLNIPYVGNGV
LASAAGMDKVIMKHIFAEAGLDQVDYVWFTRSHWEKNQEVTYELTEKEIGYPCFVKPANL
GSSVGINKCSNRDELEKAFKEAFQYDRKIIVEQGVKAREIEMGVLGNDDPKCSVPGEIVP
KKEFYDYKAKYQDNSTQLIIPAEISEKVKAEMEQIAIKAFQALDCSGLVRADFFLTEDGR
VLINEVNTMPGFTPVSMFPLLWKHSGLDYPQLIETLIDLAIKRHEEKQKIKYTV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgaaagtttgtttattatatggcgggaaatcagcggaacatgaagtttccctt
cagacagccaaagcggtgacggaagcgttggatttggaaaaattcgacgtgtatccggtt
catataaataaagaaggacaatggattaaaggaccgaaattggaaagaccggcagaaagc
gtggaagatttgcagttttcgcctcaaaaccaagagtccactcatccgttagcggctttc
ctggaaggcggtgaagagtttgatgtggtcttcccgcttttgcacggaccaaatggtgaa
gacggcacagttcaagggatgcttgaacttttaaacattccttatgtcggaaatggagtc
ttagcctcggcggcgggaatggacaaagtgatcatgaaacatatatttgcagaagcaggc
cttgaccaagtcgattatgtttggtttacgcgcagccattgggaaaaaaatcaagaagta
acatacgaattaacggaaaaagaaatcggctatccttgttttgtgaaaccggccaacctc
ggttccagcgtgggaattaacaaatgttccaatcgagatgaattggaaaaggcctttaag
gaagcttttcaatatgaccgtaaaatcattgtggaacagggagtaaaagcgagagaaata
gaaatgggagtgctcgggaacgatgatccgaaatgttccgtaccgggagaaatcgttcct
aaaaaggaattttatgattataaagcgaaatatcaagataatagtacgcaattgattata
ccggcagaaatttctgagaaagttaaggcagagatggagcaaatagcgatcaaagctttc
caagctttagattgttccggactggttcgtgccgatttctttttgacagaagacggccga
gttctgattaatgaggtcaatacgatgccgggatttacccccgtcagcatgtttccgctt
ctttggaaacatagcggtttagattaccctcagctgattgaaacattaattgatttggcc
ataaaaaggcatgaggaaaaacaaaagatcaaatacaccgtttaa

DBGET integrated database retrieval system