KEGG   Bacillus subtilis BSn5: BSn5_01030Help
Entry
BSn5_01030        CDS       T01417                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00020  Citrate cycle (TCA cycle)
bsn00310  Lysine degradation
bsn00380  Tryptophan metabolism
bsn01100  Metabolic pathways
bsn01110  Biosynthesis of secondary metabolites
bsn01120  Microbial metabolism in diverse environments
bsn01130  Biosynthesis of antibiotics
bsn01200  Carbon metabolism
Module
bsn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSn5_01030 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    BSn5_01030 (sucA)
   00380 Tryptophan metabolism
    BSn5_01030 (sucA)
Enzymes [BR:bsn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BSn5_01030 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N Amidinotransf
Motif
Other DBs
NCBI-ProteinID: ADV92840
LinkDB All DBs
Position
complement(220278..223112)
Genome map
AA seq 944 aa AA seqDB search
MFQNSMKQRMNWEDFYGPNLGYALELYDQYTQDPNSIDPDLKEMFDELGAPPSDIKEASG
TKEKGRVTADLIQKIASAVRLAEDIRTYGHLNASVNPLRKDEKKSELFPLSDYGLTEEEI
KAIPASVICKDAPKNISNGLEAIQYLRNTYKRTISFEFDHVHDFKEREWLTRKIESGELF
QKNSAEKLSAVLERLTEVEGFEQFLHRTFVGQKRFSIEGLDALVPVLDDIIAQSVKSGTT
SVNIGMAHRGRLNVLAHVLGKPYEIIFSEFQHAPNKDLVPSEGSIGISYGWTGDVKYHLG
ANRELQDAETKSARITLANNPSHLEFINPIVEGSTRAAQETRTQSGYPVQDETKSLAILI
HGDAAFPGEGIVAETLNLSSLKGYQVGGAIHIIANNMIGFTTESAESRSTKYASDLAKGY
EIPIVHVNADDPEACLSAVKFAVEYRKTFNKDFLIDLIGYRRYGHNEMDEPSTTQPMLYD
AVRKHPTVKQIFAEKLVKEGVVTEEVVQNIEKSVTKRIEDAYQKVPSKKEHTACEIELPE
PVSNGFPDVDTSIDFDVLRKLNGELINWPESFNVFGKLKRILERRAKAFDDDRKVEWSLA
ESLAFASILKDGTPIRLTGQDSERGTFAQRNLVLHDSETGKEFVPLHHLSDCSTSFAVHN
SPLSEGSVLGFEYGYNVHSPETLVLWEAQYGDFANAAQVYFDQFISAGRAKWGQKSGLVM
LLPHGYEGQGPEHSSGRIERFLQLAAENNWTVANLTSAAQYFHILRRQAKMLLREEIRPL
VIMTPKSLLRNPNTVSEVQELSESRFQPVYEQSGLSHDYEKVTRLVLSSGKVSIDISDHF
NKLEDGKEWLHIARIEQLYPFPAKGVKELFAKLPNLKEIVWVQEEPQNMGAWGYISPYLT
EIAPEGVSVQYIGRRRRSSPAEGDPTVHKKEQERIVSDSLTRKN
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaaatagtatgaaacaacgaatgaattgggaagatttttacggtccgaacctc
ggctatgcgctggagctttacgatcagtatacccaggatccgaacagcattgacccggat
ttgaaggaaatgttcgacgagctcggtgctccgccaagcgatataaaagaggcctcggga
acaaaagaaaagggacgtgttacagccgatctgattcaaaagatcgcatccgcagtcaga
cttgcagaagatatccgaacctatggccatttgaacgcttccgtcaatccgctcagaaag
gatgagaaaaagagcgaactttttccattatccgattacgggctaacagaagaggaaata
aaagcaatacctgcgtctgtcatctgcaaagacgctcctaaaaacatttcgaacggttta
gaagccattcagtatttacgaaatacgtataaaagaaccatctcttttgaatttgaccat
gtgcatgacttcaaagagcgcgagtggctgacaagaaagattgaatctggcgagctgttc
cagaagaactcagctgaaaagctgtcagctgtgctggaaagattgacagaagtagagggc
tttgagcagtttttgcaccgcacattcgtcgggcagaagcgcttttccattgagggtctg
gacgctcttgttccagtgcttgatgacattattgcacaatctgtcaaatcaggcacgaca
agtgtcaacatcgggatggcgcacaggggacgcctgaatgtcttggcacatgtgctcggc
aaaccgtatgaaatcatcttctctgaattccagcatgcgccgaacaaagatcttgtaccg
tctgagggatccattggaatcagctacggatggacgggggatgtcaaataccatttgggg
gcgaatcgggagcttcaagacgctgaaacaaaatcagcgcgcattacgttagcgaacaac
ccgagccacttggaatttatcaatccgattgttgaaggcagcacaagagcggcacaggaa
acgcgaacacaaagcggatacccggtacaagatgaaacaaaatcgctggccattttaatc
catggagacgctgcattccctggggaaggaattgtagctgaaacattgaatttaagctct
ttaaaagggtatcaagtaggcggtgcgattcatattatcgccaataacatgatcggattc
acaacagaaagcgctgaatccagatcgacaaaatatgccagcgacctggccaagggttat
gaaattccgattgttcacgtgaatgcggacgatcctgaagcttgtctttcagctgttaag
tttgcggtcgaataccgaaaaacattcaacaaggattttctgattgatttgatcgggtac
agacgctatggacacaacgaaatggatgaaccgtcaaccactcagccaatgctgtatgat
gctgtcagaaagcatccgaccgtcaaacaaattttcgctgaaaagctggtaaaagaaggc
gtggttaccgaggaagtcgttcaaaacatcgaaaaatcggtaacgaagcgcattgaggat
gcatatcagaaagttccgtctaaaaaggaacacactgcttgtgaaattgaacttccagag
cctgtatcaaacggtttcccagatgtggacacttcgattgattttgatgtgctccgcaag
ctgaatggcgaattgatcaactggccggagtcatttaatgttttcggcaagctaaagcgc
attttagaaagacgcgccaaggcgttcgatgatgacagaaaagtggaatggtctttggca
gaatcactcgcgtttgcttcaattttgaaagacggaacaccgattcgtttaacaggacag
gattccgagcgcggaacgttcgcccaaagaaaccttgtgcttcatgacagtgagacgggc
aaagaatttgtgccgcttcatcacttatctgactgcagcacatcatttgctgttcataac
agcccgctgtctgaaggatcggttctcggttttgaatacggctataacgtgcattcaccg
gaaacgcttgttttgtgggaagcacagtacggagattttgccaacgctgctcaagtgtat
tttgaccaatttatttctgccggacgcgcgaaatggggccaaaaatccggattagtcatg
ctgctcccgcacggttacgagggacaggggcctgagcactcaagcggaagaattgagcga
ttcctgcagcttgcagcggaaaacaactggacggttgccaacctgacaagcgcggcacag
tatttccatattttaagaagacaggctaaaatgctgcttcgtgaagaaatcagaccgctc
gtcattatgacgccgaagagccttcttcgcaacccaaatacggtgtcggaagtgcaggag
ctcagcgaaagccgcttccagcctgtttatgaacagtcgggactttctcatgactatgaa
aaagtaaccagacttgtattatccagcggtaaagtgtctatagacattagcgatcatttt
aataagttagaagacggtaaagagtggcttcacattgcgagaatcgaacagctgtatcca
ttcccggcaaaaggagtcaaagaattatttgcaaaacttccgaacctgaaagaaatcgtt
tgggtgcaggaagagccgcagaacatgggggcttggggttatatcagcccgtatttgaca
gagattgcaccagagggagtaagcgttcaatatattggacgaagaagacgatccagccct
gcagagggagatccgacagttcataaaaaagaacaggaacgtattgtatctgatagcttg
actcgcaaaaactaa

DBGET integrated database retrieval system