KEGG   Bacillus subtilis BSn5: BSn5_05395Help
Entry
BSn5_05395        CDS       T01417                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00020  Citrate cycle (TCA cycle)
bsn00480  Glutathione metabolism
bsn01100  Metabolic pathways
bsn01110  Biosynthesis of secondary metabolites
bsn01120  Microbial metabolism in diverse environments
bsn01130  Biosynthesis of antibiotics
bsn01200  Carbon metabolism
bsn01210  2-Oxocarboxylic acid metabolism
bsn01230  Biosynthesis of amino acids
Module
bsn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsn_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bsn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSn5_05395
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BSn5_05395
Enzymes [BR:bsn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BSn5_05395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ADV93707
LinkDB All DBs
Structure
PDB: 

Position
complement(988225..989496)
Genome map
AA seq 423 aa AA seqDB search
MAQGEKITVSNGVLNVPNNPIIPFIEGDGTGPDIWNAASKVLEAAVEKAYKGEKKITWKE
VYAGEKAYNKTGEWLPAETLDVIREYFIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFTGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSEEVQKLISFLQNELNVNKIR
FPETSGIGIKPVSEEGTSRLVRAAIDYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EKEYGDKVFTWAQYDRIAEEEGKDAANKAQSEAEAAGKIIIKDSIADIFLQQILTRPNEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLLLEHLGWNEAADLVIKSMEKTIASKVVTYDFARLMDGATEVKCSEFGEELIK
NMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtggcacaaggtgaaaaaattacagtctctaacggagtattaaacgtaccaaacaacccg
attatcccatttatcgaaggagacggaaccggtcctgatatttggaacgcggcttcgaag
gttttggaagcagcagtagaaaaagcatacaaaggcgaaaagaaaattacatggaaagaa
gtttacgccggagaaaaggcttataataaaacaggtgagtggctccctgctgaaacatta
gatgtgatccgcgaatatttcatcgcgattaaaggcccgttaacgacacctgtcggcggc
ggtatccgttctttgaacgtagcgctcagacaagagcttgacctattcgtctgcttaaga
cctgtaagatactttactggagtgccgtcaccggtaaaacgccctgaagatactgatatg
gtcatcttccgtgaaaatacagaagatatttacgcaggcatcgagtatgcaaaaggctct
gaagaagtgcaaaagcttatcagcttccttcaaaatgagttaaacgtcaacaaaatccgt
ttccctgagacatcaggtatcggcattaagcctgtttcagaagaaggaacaagccgcttg
gtcagagctgccattgattatgcgatcgagcatggccgcaaatctgtaacgcttgttcac
aaaggaaacatcatgaagttcacagaaggcgcgttcaaaaactggggctatgaacttgct
gaaaaagaatacggagataaagtcttcacatgggctcaatatgaccgcattgctgaagaa
gaaggaaaagacgctgccaacaaagcgcaaagcgaagcggaagcagcaggaaaaatcatt
atcaaagacagcattgctgacattttccttcagcagatcttaacgcgtccaaacgagttt
gatgtcgttgcgacaatgaacttgaacggagattacatttctgatgctcttgctgcgcaa
gtcggcggaatcggcattgctcctggagcgaacatcaactacgaaacaggacatgcgatt
ttcgaagcgacgcacggaacggctcctaaatatgcaggccttgataaagtaaacccatct
tcagttattctttcaggcgttctgcttcttgagcatttaggatggaacgaagcggctgat
ttggttatcaaatctatggaaaaaacaatcgcttccaaagtcgtaacttacgattttgct
agattaatggacggggcgactgaagtgaaatgctcagagttcggagaagaactgatcaaa
aacatggactaa

DBGET integrated database retrieval system