KEGG   Bacillus subtilis BSn5: BSn5_08365Help
Entry
BSn5_08365        CDS       T01417                                 

Definition
(GenBank) bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase protein
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00340  Histidine metabolism
bsn01100  Metabolic pathways
bsn01110  Biosynthesis of secondary metabolites
bsn01230  Biosynthesis of amino acids
Module
bsn_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bsn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BSn5_08365
Enzymes [BR:bsn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     BSn5_08365
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     BSn5_08365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: ADV94297
LinkDB All DBs
Position
complement(1595933..1596562)
Genome map
AA seq 209 aa AA seqDB search
MKQADELRFNEDGLIPAIVQDAASKEVLTLAYMNKESYEKTLETKETWFYSRSRQALWHK
GETSGNTQAVKGIRYDCDQDALLVLVEQSGPACHTGSYSCFTKEQAEEQAAGRFGIMNEL
ERVIAERQAEMPEGAYTTYLFREGVDKILKKVGEEASEVIIAAKNRDHEELKWEAADLLY
HLLVLLREQSLPLDDVLDVLKKRHSEKEE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggcagatgaactgcgttttaacgaggacggattaattcctgccatcgtgcag
gatgcggcaagcaaagaagtgctgacccttgcgtatatgaacaaggaatcgtacgaaaaa
acgctggaaacgaaggaaacatggttttacagccgctcacgccaagcgttatggcataaa
ggagaaacctcagggaacacgcaagccgtcaaaggtatccggtatgactgcgatcaagac
gcgctgctcgtactcgtagaacagtcaggcccggcatgccacactggcagctacagctgt
tttacaaaggaacaagcagaagaacaggccgcgggccgattcggcatcatgaacgaactg
gagcgggtgatcgcggaacgccaagcggaaatgcctgaaggagcttacaccacgtacctc
ttccgtgaaggcgtcgataagattttgaaaaaagtcggagaagaagcatccgaagtcatc
atcgccgcgaaaaaccgggatcatgaggaactcaaatgggaagcggcagacctgctgtat
cacctgcttgtcctgctcagagaacaatccctgccgctggatgatgtgcttgacgtattg
aaaaaacgccattctgagaaagaagagtaa

DBGET integrated database retrieval system