KEGG   Bacillus subtilis BSn5: BSn5_09835
Entry
BSn5_09835        CDS       T01417                                 

Definition
(GenBank) transaminase
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00998  Biosynthesis of various secondary metabolites - part 2
bsn01100  Metabolic pathways
bsn01110  Biosynthesis of secondary metabolites
Module
bsn_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bsn00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BSn5_09835
Enzymes [BR:bsn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     BSn5_09835
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: ADV94587
LinkDB
Position
complement(1873480..1874679)
AA seq 399 aa
MEITPSDVIKTLPRQEFSLVFQKVKELEKTGAHIINLGQGNPDLPTPPHIVEALREASLN
PSFHGYGPFRGYPFLKEAIAAFYKREYGVTINPETEVALFGGGKAGLYVLTQCLLNPGDI
ALVPNPGYPEYLSGITMARAELYEMPLYEENGYLPDFEKIDPAVLEKAKLMFLNYPNNPT
GAVADAAFYARAAAFAKEHHIHLIHDFAYGAFEFDQKPASFLEAEDAKIVGAELYSFSKT
FNMAGWRMAFAVGNEKIIQAVNEFQDHVFVGMFGGLQQAASAALSGDPEHTESLKRIYKE
RIDFFTALCEKELGWKMEKPKGTFYVWAEIPNTFETSHQFSDYLLENAHVVVTPGEIFGS
NGKRHVRISMVSKQEDLREFVTRIQKLNLPFGSLQETSR
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggaaataacaccgtccgatgtcatcaagacacttccaaggcaggagttttctctcgtt
tttcaaaaggtaaaggaattggaaaaaacgggggcccatatcattaatctcggacagggg
aaccctgaccttcccactccgccgcatattgtggaggctttgcgggaggcgtccttgaat
ccttcgtttcatggatacggccctttcaggggctatccttttttgaaggaagcaatcgct
gctttctataaaagagaatacggcgtgacaatcaatcctgaaacggaggtcgcgcttttc
ggaggcgggaaagccggtttgtatgtgctgacacaatgcctgctcaatccgggagacatc
gctttagtcccgaatccaggctaccctgaatatttatcagggattacgatggcgcgagct
gagctttacgaaatgccgctgtatgaagaaaatggctatctgccggattttgaaaagatt
gatccagccgtgctggaaaaagcgaagcttatgtttttaaactatccgaacaaccccact
ggagctgtggctgatgcggctttttatgcaagagctgctgcttttgcaaaagagcatcat
atccatttgattcatgattttgcatacggagcgtttgaattcgatcaaaaaccggccagc
tttcttgaggcagaggatgccaaaattgtcggagcggagctttattcattttcaaaaaca
tttaacatggccggctggagaatggcgtttgcggttgggaacgaaaagatcattcaggcc
gtcaatgaatttcaggaccatgtatttgtcggcatgttcggcgggctgcagcaggcagcg
agtgcggcgctttctggagatccggagcatacggaatcgttgaaacgaatttataaggaa
cgaattgacttttttacggcgctttgcgaaaaggaactgggctggaagatggaaaagcca
aaaggaaccttttacgtatgggctgaaattccgaatacgtttgagacatctcaccaattt
tccgattacttgctggagaatgcccatgtcgtagtcacaccgggcgaaatttttggaagc
aacggaaaaaggcatgtcagaatctcaatggtgtcgaagcaggaggatctgcgggaattt
gtcacgcggattcaaaagctgaacctgccgttcgggtcattacaagaaacatcccgctaa

DBGET integrated database retrieval system