KEGG   Bacillus subtilis BSn5: BSn5_12805Help
Entry
BSn5_12805        CDS       T01417                                 

Definition
(GenBank) 2,5-dioxovalerate dehydrogenase (alpha-ketoglutaric semialdehyde dehydrogenase)
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bsn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSn5_12805
Enzymes [BR:bsn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BSn5_12805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ADV95175
LinkDB All DBs
Position
2483345..2484811
Genome map
AA seq 488 aa AA seqDB search
MSVITEQNTYLNFINGEWVKSQSGDMVKVENPADVNDIVGYVQNSTAEDVERAVTAANEA
KTAWRKLTGAERGQYLYKTADIMEQRLEEIAACATREMGKTLPEAKGETARGIAILRYYA
GEGMRKTGDVIPSTDKDALMFTTRVPLGVVGVISPWNFPVAIPIWKMAPALVYGNTVVIK
PATETAVTCAKIIACFEEAGLPAGVINLVTGPGSVVGQGLAEHDGVNAVTFTGSNQVGKI
IGQAALARGAKYQLEMGGKNPVIVADDADLEAAAEAVITGAFRSTGQKCTATSRVIVQSG
IYERFKEKLLQRTKDITIGDSLKEDVWMGPIASKNQLDNCLSYIEKGKQEGASLLIGGEK
LENGKYQNGYYVQPAIFDNVTSEMTIAQEEIFGPVIALIKVDSIEEALNIANDVKFGLSA
SIFTENIGRMLSFIDEIDAGLVRINAESAGVELQAPFGGMKQSSSHSREQGEAAKDFFTA
IKTVFVKP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgatcacggaacaaaacacgtacctcaactttattaacggagagtgggttaag
tctcaatcaggcgatatggtcaaagtcgaaaaccctgccgatgtgaatgatattgtcgga
tatgtacagaattcaacggctgaagatgtggaacgtgccgtcaccgccgccaatgaagcc
aaaacggcttggagaaagctgacgggtgccgagcgcggccaatacttatacaaaacagcg
gatatcatggagcagcgcttggaggaaatcgccgcctgtgcaacgcgtgaaatgggtaaa
acattgccggaagcgaagggagaaacagcccgggggattgccattctgcgctattacgcc
ggagagggcatgcgaaaaacgggtgacgtcattccgtctactgacaaagacgcgctcatg
tttaccacccgtgttccgctcggtgtggtcggtgtgatttctccgtggaacttcccagtg
gcgattccgatttggaaaatggcgccggcattggtatacggcaataccgttgtcatcaaa
ccggcgacagaaacagctgtgacatgcgcgaagatcattgcctgctttgaggaagcgggg
ctcccggcaggggtcatcaatttggtgacaggcccgggttctgttgtcgggcaggggctt
gctgagcatgacggtgtaaacgccgttacgtttaccggttcaaatcaagtcggaaaaatc
atcgggcaagccgctttagcgaggggagccaaatatcagcttgagatgggcggcaaaaac
cctgtcatcgtagctgatgacgctgaccttgaagctgcggcagaagctgtcataacgggg
gccttccgttcaaccggccagaaatgcaccgcgacaagccgtgtcatcgtacaaagcgga
atttacgagcgctttaaagaaaaactgctccagcgcacaaaagatattacaatcggagac
agcttaaaagaggatgtctggatgggaccgatagccagcaagaatcagcttgataactgc
ctgtcatacattgagaaaggcaaacaggagggcgcttcccttttaataggaggagaaaag
ctggagaacggaaagtatcaaaacggctattatgttcagcctgccatctttgacaatgtg
acatctgagatgacaattgcccaggaggaaattttcggtccggtgatcgccttgatcaag
gtggactcgatagaggaggcgctgaacatcgccaatgatgtgaagttcggtttaagtgca
tccatcttcacggaaaacatcggccgaatgctttctttcattgatgaaatcgatgccggg
ctggttcggatcaatgcagaaagcgcaggtgttgagctgcaggcgccttttggcggcatg
aagcagtcgagctcccactcccgagaacagggtgaggcagcgaaggactttttcacagcg
atcaaaactgtttttgtgaagccgtaa

DBGET integrated database retrieval system