KEGG   Bacillus subtilis BSn5: BSn5_13230Help
Entry
BSn5_13230        CDS       T01417                                 

Definition
(GenBank) assimilatory nitrite reductase subunit
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00910  Nitrogen metabolism
bsn01100  Metabolic pathways
bsn01120  Microbial metabolism in diverse environments
Module
bsn_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:bsn00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BSn5_13230
Enzymes [BR:bsn01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     BSn5_13230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer2_BFD NIR_SIR Pyr_redox Rubredoxin_C NIR_SIR_ferr Pyr_redox_3 HI0933_like AlaDh_PNT_C GIDA NAD_binding_7 3HCDH_N Trp_halogenase Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: ADV95260
LinkDB All DBs
Position
complement(2570234..2572651)
Genome map
AA seq 805 aa AA seqDB search
MGKKQLVLVGNGMAGVRAIEEILSVAKDEFQITIFGAEPHPNYNRILLSKVLQGDTDIKD
ITLNDWDWYEENNIQLYTNETVIKVDTENKTVITDADRIQPYDELILATGSVPFILPIPG
ADKKGVTAFRDIKDTDTMLAASKQYKKAAVIGGGLLGLEAARGLLNLGMDVSVIHLAPFL
MERQLDATAGRLLQNELEKQGMTFLLEKQTEEIVGDDRVEGLRFKDGTSIEADLVVMAVG
IRPNTTLGAESGIPVNRGIIVNDYMQTEIPHIYAVGECAEHRGIAYGLVAPLYEQAKVLA
KHICGIETKPYEGSVLSTQLKVSGVEVFSAGDFNESEEKKAIKVFDEQDGIYKKIVLRGN
QIVGAVLFGDSSEGNRLFSMIQKEADISETSKISILQPLDQQAGTSITAAMSDDEIICGC
NGVSKGAIIQAIQEKGCSSTDEIKACTGASRSCGGCKPLVEEILQHTLGSDFDASAQKES
ICGCTTLSRDEVVEEIKAKGLSHTREVMNVLGWKTPEGCSKCRPALNYYLGMINPTKYED
DRTSRFVNERMHANIQKDGTYSVVPRMYGGVTNSTDLRKIADVVDKYEIPLVKMTGGQRI
DLIGVKKEDLPKVWEDLDMPSGYAYGKTLRTVKTCVGEQFCRFGTQDSMALGIALEKKFE
GLNTPHKVKMAVSACPRNCAESGIKDLGVVGIDGGWELYVGGNGGTHLRAGDLLMKVKTN
EEVLEYAGAYLQYYRETANYLERTSAWLERVGLSHVQFVLNDPEKRQELNDRMNETLSVH
KDPWKDFLEDKQTSKELFENVVTTS
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaaaacagctagttcttgttggtaatggaatggccggggtaagggccattgaa
gagatactgagtgttgctaaagacgagtttcagatcacaattttcggtgccgaaccgcat
cccaattacaaccgaatccttttgtcaaaagtgcttcaaggcgatacagatattaaagat
attacgttaaacgattgggactggtacgaagaaaacaacattcaattgtatacaaatgaa
acagtcatcaaagtggacacggaaaacaaaacagtcatcacagatgcagacagaatccag
ccttacgatgaattgatcttggcgacaggctcggtcccttttatccttccgattccgggc
gcagacaaaaaaggcgtcacagctttccgggacataaaagatacagacacaatgctcgcc
gcgtcaaaacaatataaaaaagctgccgtcatcggcggaggacttcttggtttggaagca
gctcgcggactgctgaatcttggcatggacgtgtccgtcatccaccttgccccattcctg
atggagcgccagcttgatgcaacggcaggacgcctgctgcaaaacgagttagaaaaacaa
ggtatgacctttttacttgaaaagcaaacagaagaaattgtcggtgatgaccgtgtcgaa
ggccttcgcttcaaagatggcacaagcattgaagctgatttagtcgtcatggctgtcggc
atccgtccgaatacaacactcggcgccgagagcggcattccggttaaccgcggcatcatc
gtcaacgattatatgcagactgaaatcccgcacatttacgcggtcggcgaatgtgccgag
caccgaggaatcgcctacgggcttgtggcaccgctctatgaacaggcaaaagtgctggcg
aagcatatttgcggcatcgaaacaaaaccgtatgagggctccgttctctccacacagtta
aaggtatcaggcgtcgaggttttctctgccggtgactttaacgaatcagaagagaaaaaa
gcgattaaagtcttcgatgagcaggacggcatctataaaaaaatcgtcctgagaggcaat
caaatagtcggtgctgttttattcggcgacagcagcgaaggcaaccgcctgttttctatg
attcaaaaagaagccgatatctctgaaacctcaaaaatatcaatcttacagcctctcgac
caacaagcaggcacaagcataaccgcagcgatgagcgacgatgaaatcatctgcggctgt
aacggcgtgtcaaaaggtgcgattattcaagccatacaggaaaagggctgctcgtcaacg
gacgagatcaaagcatgcaccggcgcatcccgctcatgcggaggctgtaagccactcgta
gaagaaatcctccagcatacgctcggatcagactttgatgcgtcagcgcaaaaagaatcc
atttgcggctgcaccacattgtcgagagatgaagtcgtagaagaaatcaaagccaaaggg
ctgtcacatacaagagaagtcatgaatgtgctcggctggaaaacgccagaaggctgttcc
aaatgccggcccgctctgaactactacttaggcatgatcaatccaaccaaatacgaggat
gaccggacatcccgctttgttaatgaacgaatgcacgccaatattcaaaaagacggaaca
tactcagtcgttcctcggatgtacggcggcgtgaccaactccacagatttgcgcaagatc
gccgatgtcgttgacaaatatgagatcccgctcgtgaaaatgacaggcggccagcgaatt
gatcttatcggcgtgaaaaaagaagaccttccgaaggtatgggaagatcttgatatgccg
tcgggctatgcgtacggaaaaacgctccgcacagtgaaaacatgtgtaggcgagcaattc
tgccgcttcggcacacaagactccatggcactgggcattgcgcttgagaaaaaattcgaa
gggctaaacacgccgcacaaagtcaaaatggccgtgtctgcatgcccgcgaaactgtgcg
gaatccggcattaaggaccttggcgttgtcggcatcgacggaggctgggagctttatgtc
ggcggaaacggcggaacccacttgcgtgccggcgatttgctgatgaaggtgaaaacaaat
gaagaagtcttagaatacgcaggcgcttacctgcaatattacagggaaaccgcaaactat
ctggagcgtacgtccgcatggcttgagcgcgtcggtttatcccatgtccaattcgtgtta
aacgatccggaaaagcggcaggagctgaacgaccgaatgaatgaaacactctctgtccac
aaggatccgtggaaagactttttagaggataaacaaacctcgaaagaattatttgaaaat
gtcgtgaccacatcataa

DBGET integrated database retrieval system