KEGG   Bacillus subtilis BSn5: BSn5_19970Help
Entry
BSn5_19970        CDS       T01417                                 

Definition
(GenBank) peptide deformylase
  KO
K01462  peptide deformylase [EC:3.5.1.88]
Organism
bsn  Bacillus subtilis BSn5
Brite
KEGG Orthology (KO) [BR:bsn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSn5_19970
Enzymes [BR:bsn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.88  peptide deformylase
     BSn5_19970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pep_deformylase
Motif
Other DBs
NCBI-ProteinID: ADV96598
LinkDB All DBs
Position
3857001..3857483
Genome map
AA seq 160 aa AA seqDB search
MAVKKVVTHPAEVLETPAETVTVFDKKLKKLLDDMYDTMLEMDGVGLAAPQIGILKRAAV
VDIGDDRGRIDLVNPEILEKSGEQTGIEGCLSFPGVYGDVTRADYVKVRAFNRQGKPFIL
EARGFLARAVQHEMDHLDGVLFTSKISKYYTEDELADMEG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
ttggcagtaaaaaaggtcgtcacacatcctgcggaggttttggaaacacctgcggaaacc
gtgactgtttttgataaaaagctaaaaaaactgcttgacgatatgtacgacaccatgctt
gaaatggatggtgtcggactggcagcgccgcaaatcggcattttaaaaagagcggcagtt
gtagacatcggggatgacagagggagaattgatctcgttaatcctgaaattttagaaaaa
agtggcgagcaaaccggaattgaaggatgcttgagctttcctggcgtctatggtgatgtc
acacgtgccgattatgtcaaagtgcgcgcgtttaaccgtcagggaaaaccattcattctg
gaagcgcgaggctttttagcaagagccgtgcagcatgaaatggaccacttagacggtgtg
ctgtttacatctaaaataagtaaatactatacagaagatgaactagcggatatggaagga
tga

DBGET integrated database retrieval system