KEGG   Bacillus subtilis BSn5: BSn5_19995Help
Entry
BSn5_19995        CDS       T01417                                 

Definition
(GenBank) protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bsn  Bacillus subtilis BSn5
Brite
KEGG Orthology (KO) [BR:bsn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsn01001]
    BSn5_19995
Enzymes [BR:bsn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BSn5_19995
Protein kinases [BR:bsn01001]
 Serine/threonine kinases: Other
  Bacterial family
   BSn5_19995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like Kdo Haspin_kinase RIO1 Seadorna_VP7 Pkinase_fungal PBP1_TM
Motif
Other DBs
NCBI-ProteinID: ADV96603
LinkDB All DBs
Position
3861631..3863577
Genome map
AA seq 648 aa AA seqDB search
MLIGKRISGRYQILRVIGGGGMANVYLAEDIILDREVAIKILRFDYANDNEFIRRFRREA
QSASSLDHPNIVSIYDLGEEDDIYYIVMEYVEGMTLKEYITANGPLHPKEALNIMEQIVS
AIAHAHQNQIVHRDIKPHNILIDHMGNIKVTDFGIATALSSTTITHTNSVLGSVHYLSPE
QARGGLATKKSDIYALGIVLFELLTGRIPFDGESAVSIALKHLQAETPSAKRWNPSVPQS
VENIILKATAKDPFHRYETAEDMEADIKTAFDADRLNEKRFTIQEDEEMTKAIPIIKDEE
LAKAAGEKEAEVTTAQENKTKKNGKRKKWPWVLLTICLVFITAGILAVTVFPSLFMPKDV
KIPDVSGMEYEKAAGLLEKEGLQVDSEVLEISDEKIEEGLMVKTDPKADTTVKEGATVTL
YKSTGKAKTEIGDVTGQTVDQAKKALKDQGFNHVTVNEVNDEKNAGTVIDQNPSAGTELV
PSEDQVKLTVSIGPEDITLRDLKTYSKEAASGYLEDNGLKLVEKEAYSDDVPEGQVVKQK
PAAGTAVKPGNEVEVTFSLGPEKKPAKTVKEKVKIPYEPENEGDELQVQIAVDDADHSIS
DTYEEFKIKEPTERTIELKIEPGQKGYYQVMVNNKVVSYKTIEYPKDE
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
gtgctaatcggcaagcggatcagcgggcgttaccaaattctccgcgttataggcggcggg
ggaatggccaacgtgtatttagctgaggatatcattctagaccgtgaagtcgcaattaaa
atcctgcggtttgactatgcaaatgacaatgaatttatcaggcgtttccgcagagaagcc
caatccgcatcaagcctcgatcacccgaatattgtcagcatttacgatttgggcgaggaa
gatgatatttattatattgtcatggaatacgttgaaggcatgacgcttaaagaatacata
acagcaaatgggccgcttcaccctaaagaagcgctgaacatcatggagcaaattgtctca
gccatcgctcatgcccatcaaaaccagattgttcacagagacatcaagccgcataacatt
ttgattgatcatatgggaaatatcaaagtaacggattttggaattgcgacggcactaagt
tcgaccacaatcacccataccaattcagttctgggctcggtccattacttatcacctgaa
caggcccggggcggcttagccacaaaaaaatcggatatttatgcgcttggaatcgttcta
tttgagcttttaaccggccgtattccgtttgatggagagtcagcagtcagcatcgccttg
aagcatcttcaagcggaaactccttcggcaaaaaggtggaatccatcggtcccccaaagc
gttgaaaacatcatactcaaggcaactgccaaagatccttttcatcgctacgaaacggct
gaagacatggaagcagacataaaaacagcttttgatgccgacagactcaatgaaaagaga
tttacgattcaagaagatgaagaaatgacaaaagcgatacctatcattaaagatgaagaa
ctcgctaaagctgctggcgaaaaagaagctgaagtgacaaccgcacaagaaaacaaaaca
aagaagaacggcaaaagaaaaaagtggccgtgggttttgctcacgatatgcctcgttttt
atcacagctggaattcttgctgtcactgtttttccgtcgcttttcatgcctaaggatgtc
aaaatacctgatgtctccggaatggaatacgaaaaagccgcagggctcttggaaaaagaa
ggtttacaggttgattccgaggtgttggaaatctcagatgaaaaaattgaagagggcctg
atggtaaaaacggatcctaaagcggataccacagtcaaagaaggcgccacggtcaccctt
tataagagcaccggaaaagcaaaaacggagatcggtgatgtgacaggccaaacggtcgac
caagcaaaaaaagcgttgaaggaccaagggtttaatcatgtaacagtaaatgaagtgaat
gacgagaaaaatgcgggcactgtcattgaccaaaatccttcagcagggactgagctggtc
ccgagtgaagatcaagtcaaacttacagtcagtatcggacccgaagacattacgcttaga
gacttgaaaacctacagtaaagaagcagcgtctggatatctggaagacaacggattgaag
cttgtagaaaaagaagcatactcagatgatgttccagaaggacaggttgtcaaacaaaaa
ccagcagcaggtacggcagtaaagccgggaaacgaagttgaagtgacattctctctcgga
ccagagaaaaaacctgcgaaaacagtgaaagaaaaggtcaagatcccctacgaaccagaa
aatgaaggggacgagcttcaagtgcaaatcgcggttgacgatgcggatcacagcatctct
gacacttacgaagaatttaagataaaagagccgactgaacgaacgatcgaactaaagatt
gaacccggccaaaaagggtactatcaagtaatggtaaacaataaagttgtcagctacaaa
accattgagtatccaaaagatgaataa

DBGET integrated database retrieval system