KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_06660Help
Entry
BSNT_06660        CDS       T02607                                 

Gene name
nasC
Definition
(GenBank) assimilatory nitrate reductase catalytic subunit
  KO
K00372  assimilatory nitrate reductase catalytic subunit [EC:1.7.99.-]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
bso00910  Nitrogen metabolism
bso01100  Metabolic pathways
bso01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bso00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BSNT_06660 (nasC)
Enzymes [BR:bso01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     BSNT_06660 (nasC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molydop_binding Molybdop_Fe4S4
Motif
Other DBs
NCBI-ProteinID: BAI83797
UniProt: D4G4Z1
LinkDB All DBs
Position
complement(353386..355518)
Genome map
AA seq 710 aa AA seqDB search
MTERLLRYFRDKQQDVQSEKTYDTQCPFCSMQCKMQLVEQTIVTRKKYTAIGIDNPTTQG
RLCMKGMNAHQHALNSSRITRPLLKKNGEFMPVSWEEALNYIKDQVTMIQVEHGHDAMAV
YGSASITNEEAYLLGKFARVGLQTKYIDYNGRLCMSAAATAANQTFGADRGLTNPLSDIP
HTRVIILAGTNIAECQPTIMPYFEKAKENGAYIIAIDPRETATTKIADLHLKIKPGTDAA
LANGLVKIIIDEQLINEDFIQSRTNGFEELKQHTDSLDLNDIAEQTSVPLADIRKAAVKF
AKETSGMLFTARGIEQQTDGTAAVKGFLNMVLITGKIGTPYSGYGAITGQGNGQGAREHG
QKADQLPGYRSIENEQHRAHVAKVWGIHQDDLPRKGVSAYEMMEKINDGDIKGLFLMCSN
PAVSSPNANLVKKALRKLTFFVAIDLFISETAKYADVILPASSYLEDEGTMTNVEGRVTL
RETSRPCPGEAKHDWQIICDLASALGKGRYFSYTSAEDIFDELREASRGGIADYSGISYG
RLRREGGIHWPCPEPDHPGIGRLFTESFAHPDQKAALSVIPNEPPVPKEKPTADYPLYLT
TGRVMSHYLTGVQTRKSAALTARHFESFIEIHPQTAATYNIEDRVLVKIESPRGSITVRS
KLSEQIRKDTVFVPIHWADAQNVNDLIGEALDPACKMPGFKVCAVRIRPI
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
ttgactgaacgactgcttagatatttccgtgataaacagcaagacgtccaatcagaaaaa
acatatgacactcaatgcccgttttgcagcatgcagtgcaaaatgcagctcgtggaacaa
accatcgtcacgcgcaaaaagtacactgcgattgggattgataatcctacaacacagggt
cggctatgcatgaagggcatgaacgcccaccagcatgccctgaactcctcccgcatcacc
cggccgctgctgaagaaaaacggcgagtttatgcctgtttcctgggaagaagcactgaat
tacattaaagaccaagtgacaatgatacaagtagaacacggccatgacgctatggcggta
tacggaagcgcctcgattacaaatgaagaggcgtatttgttagggaaattcgcacgggtg
ggcttacagacaaaatacatcgactacaacgggaggctttgtatgtccgccgcagcaacc
gcagccaaccaaacattcggcgcggacagaggcttaacgaatcccttatcagacattccc
cacacccgtgtgatcattctggccggcaccaatatcgcggagtgccagcctacgattatg
ccatattttgaaaaagcgaaagaaaacggagcttacatcattgccattgatccgcgtgaa
acagcgacaacaaaaatcgccgatcttcatttgaaaatcaaacccggcacagacgccgcc
cttgccaacggtctcgtcaaaatcatcattgacgaacagcttataaacgaggatttcatt
caatcacgaacaaatggattcgaagagctgaagcagcatactgactcgttggacctgaat
gacatcgccgaacagacgagtgtccccctggcggatataagaaaagcggctgtaaagttt
gccaaggaaacgtccggcatgctgtttacagcccgcgggattgaacagcaaaccgatgga
acagcggctgtgaaaggcttcttaaacatggtgctgatcacaggaaaaatcggtacacct
tactcaggttacggggcgatcaccggacaaggcaacgggcaaggtgcaagagagcatggc
caaaaagccgatcagcttccgggctatcgatctattgaaaacgaacaacaccgggcacat
gttgcgaaagtgtggggaatccatcaggatgatctgccgcgaaaaggtgtctcagcctat
gaaatgatggaaaaaatcaatgacggcgacatcaaaggattgttcctcatgtgctccaat
cccgctgtctccagcccaaatgcgaatcttgtgaaaaaggctttacgtaaactgacattc
tttgttgcaatcgatttgtttatttctgagactgcgaaatacgcagatgtgattttaccc
gcctcctcttacttagaagatgaaggcaccatgacaaatgtagaaggacgcgtgacatta
agagaaacaagccggccatgtcccggcgaagcaaagcatgattggcagatcatttgtgat
ctcgcatccgctctcggcaagggccgctacttttcttatacgtcagcggaggatattttt
gatgaattgagagaagcgagccgaggcgggattgccgattattcaggcatctcatacggc
aggctcagacgtgaaggcggcattcattggccgtgtccggaacctgatcatcccggaatt
ggacgcttgtttacagaatcatttgctcatccggatcaaaaagcggcattaagtgtgatt
ccaaacgagccacctgttccaaaagagaagccgacagccgattatccgctttatttaaca
acaggcagagtcatgtctcactacttaacaggcgtccaaacaagaaaaagcgccgccctt
accgcgagacattttgaatcgtttatcgaaatccatccgcaaacagcagcaacctacaat
atcgaggaccgtgtgctggtaaaaatagaatcgccgcggggaagcatcaccgtccgcagc
aaattatcagaacaaatcagaaaagatactgtttttgttcccatccattgggcagacgct
caaaatgtgaatgatttaatcggggaagccttagatccagcctgtaaaatgcccggtttt
aaggtatgcgccgtccgaatcagacctatttaa

DBGET integrated database retrieval system