KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_06670Help
Entry
BSNT_06670        CDS       T02607                                 

Gene name
yckC
Definition
(GenBank) hypothetical protein
Organism
bso  Bacillus subtilis subsp. natto BEST195
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RDD DUF2070
Motif
Other DBs
NCBI-ProteinID: BAI83807
UniProt: D4G501
LinkDB All DBs
Position
364291..364746
Genome map
AA seq 151 aa AA seqDB search
MNIYKPAGFWIRLGAALLDYIIVSVPLLLIYWLITGKDPNDSMFISLVVLLYSILLPVFW
HGYLIGKRICGIRIVKKEGSQVSLLTMFLRVIVAGLVYFITFGLGLIASLILIAVREDKR
TLHDLIAGTYVTYATPGEEELNTDEEIRKSE
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgaatatttacaaaccagccggattttggatcagacttggagctgcattgttagactac
attatagtctccgtgccgcttttgctgatctattggctgattacaggaaaagacccaaac
gacagcatgttcatcagtttggttgttctgctgtattctattttgctgccggtgttttgg
cacggttatcttatcggaaaaaggatctgcggaatcagaatcgtaaaaaaagaaggatca
caagtcagcctgttaacaatgtttttacgggttattgtagccggcctggtttactttata
accttcggactcggcttgatcgccagcctgattctgattgccgtacgagaagacaaacgg
accctgcatgatttaatcgcgggaacatatgtcacttatgcgacaccaggtgaagaagaa
cttaatactgacgaagagattagaaagagcgaataa

DBGET integrated database retrieval system