KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_07048Help
Entry
BSNT_07048        CDS       T02607                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
bso00970  Aminoacyl-tRNA biosynthesis
bso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bso00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSNT_07048 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bso03029]
    BSNT_07048 (gatB)
Enzymes [BR:bso01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BSNT_07048 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BSNT_07048 (gatB)
Mitochondrial biogenesis [BR:bso03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BSNT_07048 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey DUF3097 FIBP
Motif
Other DBs
NCBI-ProteinID: BAI84186
UniProt: D4G630
LinkDB All DBs
Position
721578..723008
Genome map
AA seq 476 aa AA seqDB search
MNFETVIGLEVHVELKTKSKIFSSSPTPFGAEANTQTSVIDLGYPGVLPVLNKEAVEFAM
KAAMALNCEIATDTKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEVGGKTKRIGITR
LHLEEDAGKLTHTGDGYSLVDFNRQGTPLVEIVSEPDIRTPEEAYAYLEKLKSIIQYTGV
SDCKMEEGSLRCDANISLRPIGQEEFGTKTELKNLNSFAFVQKGLEHEEKRQEQVLLSGG
VIQQETRRYDEATKKTILMRVKEGSDDYRYFPEPDLVELYIDDEWKERVKASIPELPDER
RKRYIEELGLPAYDAMVLTLTKEMADFFEETVQKGAEAKQASNWLMGEVSAYLNAEQKEL
ADVALTPEGLAGMIKLIEKGTISSKIAKKVFKELIEKGGDAEKIVKEKGLVQISDEGVLL
KLVTEALDNNPQSIEDFKNGKDRAIGFLVGQIMKASKGQANPPMVNKILLEEIKKR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
ttgaactttgaaacggtaatcggacttgaagtccacgttgagttaaaaacaaaatcaaaa
attttctcaagctctccaacgccattcggcgcggaggcgaatacgcagacaagcgttatt
gacctcggatatccgggcgtcctgcctgttctgaacaaagaagccgttgaattcgcaatg
aaagccgctatggcgctcaactgtgagatcgcaacggatacgaagtttgaccgcaaaaac
tatttctatcctgacaacccgaaagcgtatcagatttctcaatttgataagccaatcggc
gaaaacggctggatcgaaattgaagtcggcggcaaaacaaaacgcatcggcatcacgcgc
cttcatcttgaagaggatgccggaaaactgacgcatacgggcgacggctattctcttgtt
gacttcaaccgtcaaggaacgccgcttgttgagatcgtatcagagccggacatccgcacg
ccggaagaagcgtacgcgtatcttgaaaagctgaaatccatcatccagtatacaggcgtt
tctgactgtaaaatggaagaaggctcacttcgctgtgacgccaatatctctcttcgtccg
atcggccaagaggaatttggcacaaaaacagaattgaaaaacttgaactcctttgcgttt
gttcaaaaaggccttgagcatgaagaaaaacgccaggagcaggttcttctttccggcggc
gtcatccagcaagaaactcgccgttatgatgaagcaacgaagaaaaccattcttatgcgt
gtcaaagagggatctgacgactaccgttacttcccagagccggatctagtcgagctctac
attgatgatgaatggaaggaacgcgtaaaagcaagcattcctgagcttccggatgagcgc
cgcaagcgttatatcgaagagcttggcttgcctgcatatgacgcgatggttctgacgctg
acaaaagaaatggctgatttcttcgaagaaaccgttcaaaaaggcgctgaagccaaacaa
gcgtctaactggctgatgggtgaagtgtcagcttacctaaacgctgagcaaaaagagctt
gccgatgttgccctgacacctgaaggccttgccggcatgatcaaattgattgaaaaagga
accatttcttctaagatcgcgaagaaagtgtttaaagaattgattgaaaaaggcggcgac
gctgagaagattgtgaaagagaaaggccttgttcagatttctgacgaaggcgtgcttctg
aagcttgtcactgaggcgcttgacaacaatcctcaatcaatcgaagactttaaaaacgga
aaagaccgcgcgatcggcttcctagtcggacagattatgaaagcgtccaaaggacaagcc
aacccgccgatggtcaacaaaattctgcttgaagaaattaaaaaacgctaa

DBGET integrated database retrieval system