KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_07122Help
Entry
BSNT_07122        CDS       T02607                                 

Gene name
yfmT
Definition
(GenBank) hypothetical protein
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
bso00627  Aminobenzoate degradation
bso01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bso00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BSNT_07122 (yfmT)
Enzymes [BR:bso01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     BSNT_07122 (yfmT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAI84259
UniProt: D4G6A3
LinkDB All DBs
Position
795473..796939
Genome map
AA seq 488 aa AA seqDB search
MLTMFQYEELNKQFIGGKWQEGSSPNVLENKNPYTQKTFTTFRKATADDVDEAYRAAALA
KKKWDAVNPFEKRTILEKAVTYIEENEEAIIYLIMEELGGTRLKAAFEIGLVKNIMKEAA
TFPIRMEGKILPSTIDGKENRLYRVPAGVVGVISPFNFPFFLSMKSVAPALGAGNGVVLK
PHEETPICGGTLIAKIFENAGIPAGLLNVVVTDIAEIGDSFVEHPVPRIISFTGSTKVGS
YIGQLAMKHFKKPLLELGGNSAFIVLEDADIEYAVNAAVFSRFTHQGQICMSANRVLVHS
SIYDKFLELYQAKVESLKVGDPMDPDTIIGPLINSRQTDGLMKTVEQAIEEGAVPVKLGG
FNGTIVEPTILKDVKPFMSIAKEELFGPVVSFMKFDSEDEAVDIANETPFGLSGAVHTSN
LERGVAFAKRIETGMIHVNDTTINDEPNVAFGGEKQSGLGRLNGEWSLEEFTTLKWISVQ
HEKRSFPY
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccatgtttcaatatgaagagttgaataaacagtttatcggcgggaaatggcag
gagggcagcagcccaaatgtattggaaaacaaaaatccttatactcaaaaaacattcaca
acattccgtaaagcgactgctgacgatgtagatgaagcgtatcgggcagcggcgctggca
aagaaaaaatgggatgcggtcaacccgtttgagaaaagaacaattttagaaaaagccgtc
acgtatattgaagaaaatgaagaagccattatttatttaattatggaggagctaggcggt
acaaggctcaaagcggcttttgaaatcggacttgtcaaaaacatcatgaaagaagcggca
acgttcccaatccgcatggaggggaaaattcttccgtccacaatagatggcaaggaaaac
agattatatcgtgtgccagcaggcgttgtcggtgtcatcagtccgtttaacttcccattc
tttttatctatgaaatcagtggcgcctgcactcggagccggcaatggcgttgtgctaaag
ccgcatgaggaaacgccgatttgcggcggaacgctgatcgcgaaaatttttgagaacgcg
ggaattccagcggggctgctgaatgttgttgtcacagacattgcagaaatcggcgacagc
tttgttgagcatccagtgccgcggatcatctcatttaccggttctacgaaagtcggcagc
tacattggacagcttgcgatgaagcattttaaaaagccgcttcttgagcttggcggaaac
agcgccttcatcgtactggaggatgcagatatagaatatgcggtcaatgcggcggtgttc
agccgatttacacatcaaggacagatttgcatgtcagccaaccgcgtgcttgttcattct
tctatttatgacaagttccttgagctgtaccaggcaaaagtggaatcgctgaaagtcggc
gacccaatggatcctgatacgattatcgggccattaatcaacagcagacagacggacggg
ctgatgaagactgttgagcaagcaattgaagaaggcgctgtaccagtgaagcttggcgga
tttaacgggacgatcgtggaaccgacgatcttaaaagacgtcaaaccgttcatgagcatt
gccaaggaagagctgttcggaccagtcgtctcctttatgaagtttgattcagaagacgaa
gcggtggatatcgcaaacgaaaccccgtttggcttgagcggtgctgtacatacgtcaaat
cttgagcgcggcgtggcatttgcgaaacgcattgaaacaggcatgattcacgtcaatgac
acgaccatcaatgatgaaccgaatgtagccttcggcggtgaaaagcaatcaggcctcggc
cgtttaaatggtgagtggagcctcgaagaatttacaacgctgaaatggatctcggtccag
cacgaaaaacgcagcttcccttattaa

DBGET integrated database retrieval system