KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_08258Help
Entry
BSNT_08258        CDS       T02607                                 

Gene name
nrdF
Definition
(GenBank) ribonucleotide-diphosphate reductase subunit beta
  KO
K00526  ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
bso00230  Purine metabolism
bso00240  Pyrimidine metabolism
bso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bso00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSNT_08258 (nrdF)
   00240 Pyrimidine metabolism
    BSNT_08258 (nrdF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bso03400]
    BSNT_08258 (nrdF)
Enzymes [BR:bso01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     BSNT_08258 (nrdF)
DNA repair and recombination proteins [BR:bso03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BSNT_08258 (nrdF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_sm DUF2247
Motif
Other DBs
NCBI-ProteinID: BAI85362
UniProt: D4FWY1
LinkDB All DBs
Structure
PDB: 

Position
1814284..1815273
Genome map
AA seq 329 aa AA seqDB search
MTKIYDAANWSKHEDDFTQMFYNQNVKQFWLPEEIALNGDLLTWKYLGKNEQDTYMKVLA
GLTLLDTEQGNTGMPIVAEHVDGHQRKAVLNFMAMMENAVHAKSYSNIFMTLAPTETINE
VFEWVKQNKYLQKKAQMIVGLYKAIQKDDEISLFKAMVASVYLESFLFYSGFYYPLYFYG
QGKLMQSGEIINLILRDEAIHGVYVGLLAQEIYNKQTEEKKAELREFAIDLLNQLYENEL
EYTEDLYDQVGLSHDVKKFIRYNANKALMNLGFDPYFEEEDINPIVLNGLNTKTKSHDFF
SMKGNGYKKATVEPLKDDDFYFEDEKEQI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaaaatttatgacgcagcaaactggtcaaagcatgaagacgattttacccaaatg
ttctataaccaaaacgtgaaacagttctggcttccggaagagattgctttaaacggcgat
ctcctcacatggaagtacctcggaaaaaatgagcaggacacttatatgaaggtactggcc
ggacttacgcttcttgatacagagcaggggaatacggggatgccgatcgtggctgaacac
gtagacggccaccagcggaaagcggtgctgaactttatggcgatgatggagaacgctgtc
catgcgaagtcgtactctaatattttcatgacccttgcaccgactgaaacgatcaatgaa
gtatttgaatgggttaaacaaaataaatatttgcagaaaaaagcgcaaatgattgtcggg
ctttacaaagccattcaaaaagatgatgaaatttcactgttcaaagccatggttgcttcc
gtctatctggaaagcttccttttctacagcggtttctattatccgttatatttctacgga
caaggaaaactgatgcaaagcggtgagatcattaacctgatccttcgtgacgaagcgatt
cacggcgtgtatgtcggtctccttgctcaggaaatttataataaacagacagaagagaaa
aaagcagagcttcgtgaatttgcgattgaccttctgaatcagttatatgaaaatgagctt
gagtatacagaggacttgtacgatcaagtcggactctcacacgatgtaaagaaattcatc
cgctataatgcgaataaagcgctgatgaatcttggatttgatccatacttcgaagaggaa
gatattaatccgatcgtattaaacggattaaacacaaaaacaaaatcgcatgacttcttc
tctatgaaggggaatggttataaaaaagcgacagttgagccgctcaaagatgatgacttt
tattttgaagatgaaaaagagcagatataa

DBGET integrated database retrieval system