KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_09092
Entry
BSNT_09092        CDS       T02607                                 

Gene name
levG
Definition
(GenBank) phosphotransferase system (PTS) fructose-specific enzyme IID component
  KO
K02771  fructose PTS system EIID component
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
bso00051  Fructose and mannose metabolism
bso02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSNT_09092 (levG)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSNT_09092 (levG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bso02000]
    BSNT_09092 (levG)
Transporters [BR:bso02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BSNT_09092 (levG)
SSDB
Motif
Pfam: EIID-AGA
Other DBs
NCBI-ProteinID: BAI86178
UniProt: D4FZ97
LinkDB
Position
complement(2517353..2518198)
AA seq 281 aa
MRGEEKMEKEKRLTKKEIFSMFIRSNFLLGSFNFERVQAMGYCYVMIPAIKKLYGPGAKR
NEALQRHLEWFNTHPWLTAPIFGVTAAMEEEMANNKGIDGKAISGMKIGLMGPIAGVGDP
IFWGTIRPVLAALGASLALGGNIAGPLLFFFLLNAIRLSTKYYGLKYGYVKGMEILQDLA
GNRIQKLTEGASILGLFVMGALVSKWTTINIPIVVSRIKDESGKVDVQTVQNVLDSIMPG
ALPLGLTLLVAWMLRKGVNPLLIICGIFVIGILGYWAGFLA
NT seq 846 nt   +upstreamnt  +downstreamnt
atgaggggggaagaaaaaatggagaaagaaaaacgattaacgaagaaagaaattttcagc
atgtttattcgttcaaattttttactcggttcctttaacttcgaacgtgtgcaggcaatg
ggatattgttatgtcatgataccggcgatcaaaaaattgtacggtcccggagcgaaaaga
aacgaagccttgcagcggcatttggaatggtttaatacacatccgtggctgacagcgcct
atatttggcgtgacggcagccatggaagaagaaatggcgaacaataaaggaattgacgga
aaagcgataagcggaatgaaaattggtttgatgggaccaatagcgggcgtaggcgaccca
attttctggggaacgattcgtcctgtcttagctgcgctaggagcctcccttgctttagga
ggaaacattgccggccctttgctattctttttcttgctgaatgccataagattaagcaca
aaatattacggattaaagtatggctatgtgaaaggaatggagattcttcaggatttagcg
gggaatcgcattcaaaagcttacagagggcgcttcgattctcgggttatttgttatgggg
gctctcgtgtccaaatggaccaccatcaacattccaatcgttgtatccaggattaaggat
gaaagcggaaaagtagatgttcaaacggtacaaaacgtgctagacagcattatgccgggg
gcgctgcctctcggattaacgttattggtggcatggatgcttcgcaaaggggtgaatcct
cttctcattatttgcggcatctttgtcatcgggattctcgggtattgggctggattctta
gcataa

DBGET integrated database retrieval system