KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_09093
Entry
BSNT_09093        CDS       T02607                                 

Gene name
levF
Definition
(GenBank) phosphotransferase system (PTS) fructose-specific enzyme IIC component
  KO
K11196  fructose PTS system EIIC component
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
bso00051  Fructose and mannose metabolism
bso02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSNT_09093 (levF)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSNT_09093 (levF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bso02000]
    BSNT_09093 (levF)
Transporters [BR:bso02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BSNT_09093 (levF)
SSDB
Motif
Pfam: EII-Sor TMEM251
Other DBs
NCBI-ProteinID: BAI86179
UniProt: D4FZ98
LinkDB
Position
complement(2518202..2519011)
AA seq 269 aa
MSSLQIILLLIIAAITGIASVLDEGQTHRPLVACTLVGLVLGDLKTGIILGGTLELMALG
WMNVGLAMAPDTAIASVISTILVITADQGIGEGIAVAVALAAAGQALTIFVRTITVFFIH
RADQYAKAGNIRGIEIMHITAMVFQALRVMIPTLIVALISVSAVQAFLGNIPDVITKGLQ
IGGGIIVVVGYAMVINMMNIPYLKPFFYIGFLLAAFTDFNLVGFGALGLCLALLYQQVMQ
KQSAHGAVAAASDSGSVAVYDDDDDDLDA
NT seq 810 nt   +upstreamnt  +downstreamnt
atgtcttcattacaaattattttgttgttaatcattgcagcaatcaccggaatcgcaagt
gtattggatgaagggcagacacaccgtccgcttgtggcctgtacgttagttggcttggtg
ctcggggacttaaaaacgggaattattcttggaggcacactggagctgatggcgctcggc
tggatgaacgtcgggcttgccatggcacctgatacagcgatcgcctctgtcatctcaacc
attttagttattaccgctgatcagggaattggcgaagggattgctgtcgctgttgcttta
gcagctgcgggtcaggcgctgacgatttttgttcggacgatcactgtctttttcatccac
cgcgctgatcaatatgcaaaagcgggaaatataagaggaattgaaattatgcatattacc
gcgatggtgtttcaagctttgcgcgtcatgattcctacattgattgttgctttaattagt
gtcagcgctgttcaggcgttcctgggaaatattcctgatgtcattacaaaaggactgcaa
ataggcggaggcattattgtggttgtcgggtatgccatggtgatcaatatgatgaatatt
ccttatttaaagccatttttctatattggtttcttattagcggcgtttaccgattttaac
ttagtgggatttggagcccttggtctctgtctggcgcttttataccagcaggtgatgcaa
aaacaaagcgctcacggagcagtcgcggccgcatcagacagtggcagtgttgctgtttat
gatgacgatgatgatgatcttgatgcctaa

DBGET integrated database retrieval system