KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_09094
Entry
BSNT_09094        CDS       T02607                                 

Gene name
levE
Definition
(GenBank) phosphotransferase system (PTS) fructose-specific enzyme IIB component
  KO
K11195  fructose PTS system EIIB component [EC:2.7.1.202]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
bso00051  Fructose and mannose metabolism
bso02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSNT_09094 (levE)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSNT_09094 (levE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bso02000]
    BSNT_09094 (levE)
Enzymes [BR:bso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     BSNT_09094 (levE)
Transporters [BR:bso02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BSNT_09094 (levE)
SSDB
Motif
Pfam: PTSIIB_sorb Msg2_C
Other DBs
NCBI-ProteinID: BAI86180
UniProt: D4FZ99
LinkDB
Structure
PDB: 
1BLE

Position
complement(2519028..2519519)
AA seq 163 aa
MMNIVLARIDDRFIHGQILTRWIKVHAADRIIVVSDDIAQDEMRKTLILSVAPSNVKASA
VSVSKMAKAFHSPRYEGVTAMLLFENPSDIVSLIEAGVPIKTVNVGGMRFENHRRQITKS
VSVTEQDIKAFETLSDKGVKLELRQLPSDASEDFVQILRNVTK
NT seq 492 nt   +upstreamnt  +downstreamnt
atgatgaacattgtgttagcaagaatcgatgaccgctttattcacggccaaatcctgaca
aggtggataaaagtccatgcagccgaccgaatcatcgttgtctccgacgatattgctcag
gacgaaatgagaaaaacgctgatcctttctgttgcgccttcaaatgtaaaggcgagtgcc
gtctcggtttctaaaatggcaaaagcatttcatagtccgcgctacgaaggcgtaacagca
atgctcttgtttgaaaatccgtccgatattgtatctcttatagaagcaggtgtaccgatc
aaaaccgtaaacgtcgggggaatgcgttttgaaaatcaccgcaggcaaatcacaaaatca
gtcagtgtcacagaacaagatataaaggcatttgaaacattaagtgacaagggcgtgaaa
ctggaattgaggcagctgccttcagatgccagtgaggattttgtacagattttacggaac
gtaacaaaataa

DBGET integrated database retrieval system