KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_09342Help
Entry
BSNT_09342        CDS       T02607                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
bso00010  Glycolysis / Gluconeogenesis
bso00030  Pentose phosphate pathway
bso00051  Fructose and mannose metabolism
bso00052  Galactose metabolism
bso00680  Methane metabolism
bso01100  Metabolic pathways
bso01110  Biosynthesis of secondary metabolites
bso01120  Microbial metabolism in diverse environments
bso01130  Biosynthesis of antibiotics
bso01200  Carbon metabolism
bso01230  Biosynthesis of amino acids
bso03018  RNA degradation
Module
bso_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bso_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSNT_09342 (pfkA)
   00030 Pentose phosphate pathway
    BSNT_09342 (pfkA)
   00051 Fructose and mannose metabolism
    BSNT_09342 (pfkA)
   00052 Galactose metabolism
    BSNT_09342 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    BSNT_09342 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BSNT_09342 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:bso01009]
    BSNT_09342 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bso03019]
    BSNT_09342 (pfkA)
Enzymes [BR:bso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BSNT_09342 (pfkA)
Protein phosphatases and associated proteins [BR:bso01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BSNT_09342 (pfkA)
Messenger RNA biogenesis [BR:bso03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BSNT_09342 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: BAI86429
UniProt: D4FZZ8
LinkDB All DBs
Structure
PDB: 

Position
complement(2758259..2759218)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYAGLISGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMHEIIARLKRGHERGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSAADRVLASRLGAYAVELLLEGKGGRCVGIQNNKLVDHDIIEIL
ETKHTVEQNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtataggggtattaacgagcggcggggattccccgggaatgaacgcagcagtt
cgcgcagtagtcagaaaagcgatctatcatgacgttgaagtttacggtatttacaacgga
tacgcgggattgatcagcggaaagattgaaaagcttgaactcggatcagtaggcgatatt
atacatcgtggaggaactaagctttatacggcaagatgtcctgaattcaaaacagttgaa
ggccgtgaaaaagggatagaaaacttgaagaagcttggtattgaaggccttgttgttatc
ggcggagacggttcatatatgggtgcgaaaaaattaacggaacacgggtttccatgtgta
ggtgtaccgggtacaattgataatgacattccgggcactgattttacaatcggtttcgat
acagctttaaatacagtaattgacgcaattgataagattcgcgatacagcgacttctcat
gaacgtacatatgtaatcgaagtaatgggccgtcatgccggcgatatcgcattgtgggcc
ggtcttgcagggggcgcggaatcgatcttaatccctgaggcagactatgacatgcacgaa
atcattgcccgcttaaaacgcggccacgaacgcggcaagaagcacagtattattattgtt
gccgaaggtgtaggcagcggtgttgaattcgggaaacgcattgaagaagaaacaaatctt
gaaactagggtatctgtattgggccatatccagcgcggaggttctccgagtgctgctgac
cgtgtgttagcaagccgtctcggcgcatatgcagttgaactgctgcttgaaggaaaaggc
ggacgctgtgtaggtatacaaaacaataagcttgtagaccatgatattatagaaatactt
gagacaaaacacacagttgagcaaaacatgtatcagctttcaaaagaactgtctatctaa

DBGET integrated database retrieval system