KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_09372Help
Entry
BSNT_09372        CDS       T02607                                 

Gene name
ytcI
Definition
(GenBank) hypothetical protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
bso00010  Glycolysis / Gluconeogenesis
bso00620  Pyruvate metabolism
bso00630  Glyoxylate and dicarboxylate metabolism
bso00640  Propanoate metabolism
bso00680  Methane metabolism
bso01100  Metabolic pathways
bso01110  Biosynthesis of secondary metabolites
bso01120  Microbial metabolism in diverse environments
bso01130  Biosynthesis of antibiotics
bso01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSNT_09372 (ytcI)
   00620 Pyruvate metabolism
    BSNT_09372 (ytcI)
   00630 Glyoxylate and dicarboxylate metabolism
    BSNT_09372 (ytcI)
   00640 Propanoate metabolism
    BSNT_09372 (ytcI)
  09102 Energy metabolism
   00680 Methane metabolism
    BSNT_09372 (ytcI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bso01004]
    BSNT_09372 (ytcI)
Enzymes [BR:bso01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BSNT_09372 (ytcI)
Lipid biosynthesis proteins [BR:bso01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BSNT_09372 (ytcI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAI86461
UniProt: D4G030
LinkDB All DBs
Position
complement(2785741..2787357)
Genome map
AA seq 538 aa AA seqDB search
MGGESEELFVLKREDLIAPMQYNLVNEMEKFSAAGQKTALLWEDESGKQESWSYEKLMEE
TNKIGAALADLGFKKGDKLIVMVPRVLEAYAVYLAILKSGMVVIPCSEMLRAKDLEYRIE
HAEVKGAIVYSEFIGAFRDVSTTDKLITLSIGENDADWKNLLSIEADGSQFKTADTTRDD
MAFLSYTSGTTGQPKGVVHTHGWAFAHLKTSAGAWLDISEKDIVWATAAPGWQKWVWSPF
LAVLGSGATGFVYHGRFKAEKYLELLNRYKINVFCCTPTEYRLMAKVEGLDRFDLSALHS
AVSAGEPLNREVIDVFQKHFGIKVRDGYGQTESTLLVGVLKDTPIKPGSMGKPTPGNQVE
IINEDGEICKPGEVGDIAVHLSTPALFKEYFKDPERMKTQIRGDYFLTGDRARKDEEGYF
WFESRNDDIIISSGYTIGPFEVEDALVKHPEVKECAVVASPDEIRGSIVKAYVVLQNHEK
RSDELVKMLQNHVKTITAPYKYPREIEFVESLPKTASAKIRRVELRKREEQLKANKKA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgggtggagaaagtgaggagttgttcgtgttaaaacgtgaagatttaattgcccctatg
caatataatttagtgaatgaaatggaaaagttcagtgccgctggacaaaaaaccgctctt
ctgtgggaggacgagtcgggtaagcaagaatcttggtcgtatgaaaagctgatggaagaa
acaaataaaatcggagcggccttagctgatcttggatttaaaaagggagacaagctgatt
gtaatggttccgcgggtgcttgaagcctatgctgtttatttggctatcctgaaatcagga
atggttgtcattccgtgctccgaaatgcttcgcgcgaaagatcttgaataccggattgaa
catgcagaggtaaaaggcgctatcgtctactcagaatttattggcgctttccgggatgtc
agtacgactgacaaactgattacactgtctattggtgaaaatgatgccgactggaaaaac
ctcttatcaattgaagcggacggaagccaatttaaaacagctgacacaacaagagatgat
atggctttcttatcttatacatccgggacaacaggtcagccgaaaggtgttgtacataca
catggatgggcatttgctcatttaaaaacttctgccggcgcttggcttgatatttctgaa
aaggatatcgtctgggcaactgctgcccctggctggcaaaagtgggtatggagtccgttt
ttagcggtgcttggcagcggagcaaccggttttgtgtaccacggcagattcaaagcagaa
aaatatctagagcttttaaatcgctacaaaatcaatgttttctgctgcacgcctacagaa
taccgcttaatggcgaaggttgaaggcttggaccgttttgatctttctgccctgcacagc
gctgtttccgcaggtgagccgctcaaccgtgaagtcattgatgttttccaaaagcacttt
ggcattaaggtacgggacggatatggccaaacagaaagcacgcttttggttggtgttttg
aaagatacgcctattaaaccgggaagcatgggaaaaccgacaccgggaaatcaggtggag
atcataaatgaagacggtgaaatctgcaaacctggtgaggttggcgatatcgctgttcac
ctcagtacgcctgcgctctttaaagagtattttaaagatccggaaagaatgaaaacacaa
attcgcggcgattatttcctaacgggagacagagcaagaaaagatgaggaaggttacttc
tggtttgaaagccgaaatgacgatattattatcagctccggctatacgatcgggcctttc
gaggtggaagacgcgcttgttaagcacccagaagtaaaagaatgtgctgttgtcgcaagc
cctgatgaaatcagaggctccatcgtaaaggcatatgttgtcctgcaaaatcatgaaaaa
cgcagtgatgagcttgtcaaaatgctgcaaaaccatgtgaagacgattaccgctccatac
aaatatcctagagaaattgaatttgtggaaagcctgccgaaaacggcttctgcaaaaatc
agacgagtggaattaagaaaacgtgaagaacagctcaaagccaataaaaaggcgtaa

DBGET integrated database retrieval system