KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_10427
Entry
BSNT_10427        CDS       T02607                                 

Gene name
ywfG
Definition
(GenBank) transaminase
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
bso00998  Biosynthesis of various secondary metabolites - part 2
bso01100  Metabolic pathways
bso01110  Biosynthesis of secondary metabolites
Module
bso_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bso00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BSNT_10427 (ywfG)
Enzymes [BR:bso01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     BSNT_10427 (ywfG)
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: BAI87431
UniProt: D4G2V0
LinkDB
Position
complement(3740282..3741496)
AA seq 404 aa
MEITPSDVIKTLPRQEFSLVFQKVKEMEKTGAHIINLGQGNPDLPTPPHIVEALREASLN
PSFHGYGPFRGYPFLKEAIAAFYKREYGVTINPETEVALFGGGKAGLYVLTQCLLNPGDI
ALVPNPGYPEYLSGITMARAELYEMPLYEENGYLPDFEKIDPAVLEKAKLMFLNYPNNPT
GAVADAAFYARAAAFAKEHNIHLIHDFAYGAFEFDQKPASFLEAEDAKIVGAELYSFSKT
FNMAGWRMAFAVGNERIIQAVNEFQDHVFVGMFGGLQQAASAALSGDPEHTESLKRIYKE
RIYKERIDFFTALCEKELGWKMEKPKGTFYVWAEIPNTFETSHQFSDYLLEHAHVVVTPG
EIFGSNGKRHVRISMVSKQEDLREFVTRIQKLNLPFGSLQETSR
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggaaataacaccgtccgatgtcatcaagacacttccaaggcaagagttttctctcgtt
tttcaaaaggtaaaggaaatggaaaaaacgggggcccatatcattaatctcggacagggg
aaccctgaccttcccactccgccgcatattgtggaggctttgcgggaggcttctctgaat
ccttcgtttcatggatacggccctttcaggggctatccttttttaaaggaagcgatcgct
gctttctataaaagggaatacggagtgacaatcaatcctgaaacggaggtcgcgcttttc
ggaggcgggaaagccggtttgtatgtgttgacacaatgcctgctcaatccgggagacatc
gctttagtcccgaatccaggctaccctgaatatttatcagggattacgatggcgcgagct
gagctttacgaaatgccgctgtatgaagaaaatggctatctgccggattttgaaaagatt
gatccagccgtgctggaaaaagcgaagcttatgtttttaaactatccgaacaatcccact
ggagctgtggctgatgcggctttttatgcaagagctgctgcttttgcgaaagagcataac
atccatttgattcatgattttgcatacggagcgtttgaattcgatcaaaaaccggccagt
tttcttgaggcagaggatgccaaaattgtcggagcagagctttattcattttcaaaaaca
tttaacatggccggctggagaatggcgtttgcggttgggaacgaaaggatcattcaggcc
gtcaatgaatttcaggatcatgtatttgtcggcatgttcggcgggctgcagcaggcagcg
agtgcggcgctttctggagatccggagcatacggaatcgttgaaacgaatttataaggaa
cgaatttataaggaacgaattgacttttttacggcgctttgtgaaaaggaattgggctgg
aagatggaaaagccaaaaggaaccttttacgtatgggctgaaattccgaatacgtttgag
acatctcaccaattttccgattacttgctggagcatgcccatgtcgtagtcacaccgggc
gaaatttttggaagcaacggaaaaaggcatgtcagaatttcaatggtgtcgaagcaggag
gatctgcgggaatttgtcacgcggattcaaaagctgaacctgccgttcgggtcattacaa
gaaacatcccgctaa

DBGET integrated database retrieval system