KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_10788Help
Entry
BSNT_10788        CDS       T02607                                 

Gene name
yyaT
Definition
(GenBank) hypothetical protein
Organism
bso  Bacillus subtilis subsp. natto BEST195
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_10 Acetyltransf_1 Acetyltransf_7 Acetyltransf_5 FR47 Acetyltransf_9 Acetyltransf_4
Motif
Other DBs
NCBI-ProteinID: BAI87785
UniProt: D4G482
LinkDB All DBs
Position
4072938..4073384
Genome map
AA seq 148 aa AA seqDB search
MNIKRITTEADLHEALNIRKTVFIEEQHVSESEEFDEFDTLQEQCQHVLVYHENQPVGTG
RVRIVGHTAKLERICILKPYRKYGLGKVIVSGLEEIIKEKGLTACKLHGQTQAAGFYQKL
GYQISSQAFMEDGIPHVLMTKDISRNIT
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaatataaaaagaataacaactgaagctgatttacatgaagctttgaatattagaaag
acggttttcattgaggagcaacatgtatcggaatccgaagagttcgatgaatttgatacg
ctccaggaacaatgccagcatgtcttggtatatcatgagaatcagcctgtcggcacgggc
cgtgtgcgcatcgttggccatacagcaaagctggaaagaatctgcatcctaaaaccttac
cgtaagtacggattggggaaagtcatcgtaagcgggttagaagaaatcataaaagaaaaa
ggattgactgcatgtaagctgcatggtcaaacacaagcagcaggcttttatcaaaaactg
ggctaccagatttcttcacaggcatttatggaagacggcatccctcatgtcttgatgaca
aaagacatatcgcggaatataacatga

DBGET integrated database retrieval system