KEGG   Baekduia soli: FSW04_01705Help
Entry
FSW04_01705       CDS       T06127                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bsol  Baekduia soli
Pathway
bsol00071  Fatty acid degradation
bsol00280  Valine, leucine and isoleucine degradation
bsol00281  Geraniol degradation
bsol00310  Lysine degradation
bsol00362  Benzoate degradation
bsol00380  Tryptophan metabolism
bsol00410  beta-Alanine metabolism
bsol00640  Propanoate metabolism
bsol00650  Butanoate metabolism
bsol00903  Limonene and pinene degradation
bsol00930  Caprolactam degradation
bsol01100  Metabolic pathways
bsol01110  Biosynthesis of secondary metabolites
bsol01120  Microbial metabolism in diverse environments
bsol01130  Biosynthesis of antibiotics
bsol01200  Carbon metabolism
bsol01212  Fatty acid metabolism
Module
bsol_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bsol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    FSW04_01705
   00650 Butanoate metabolism
    FSW04_01705
  09103 Lipid metabolism
   00071 Fatty acid degradation
    FSW04_01705
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FSW04_01705
   00310 Lysine degradation
    FSW04_01705
   00380 Tryptophan metabolism
    FSW04_01705
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FSW04_01705
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    FSW04_01705
   00281 Geraniol degradation
    FSW04_01705
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FSW04_01705
   00930 Caprolactam degradation
    FSW04_01705
Enzymes [BR:bsol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     FSW04_01705
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     FSW04_01705
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     FSW04_01705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 NAD_Gly3P_dh_N DAO AlaDh_PNT_C UDPG_MGDP_dh_N NAD_binding_8 F420_oxidored Thi4 GIDA
Motif
Other DBs
NCBI-ProteinID: QEC46417
UniProt: A0A5B8U0A1
LinkDB All DBs
Position
complement(392649..394880)
Genome map
AA seq 743 aa AA seqDB search
MASTIRWDQDGDGVVLLTFDDPGQSANTMNAAYAASMRATVERLEAEKDDIAGVVITSAK
KTFFAGGDLHDLIRVTKADAPELDAALREGKALLRRLETLGRPVVAAINGAALGGGLEIC
LACHHRVIVDDPKAVVGFPEVQLGLLPGAGGVVRSVRMLGITDALMQLLLQGQRLRPAKA
LELGVVDEVVATRDELVPAAKAWIAAHRDEEIVQPWEVKGYKIPGGTPSSPKLAAMLPAF
PANLRKQIKGANYPAPHHIMAAAVESTQVDFDTAIEIEGRYFLDLVTGQVAKNMIQAFFF
DLQQVNGERGRPSDIPPFAATKVVVLGAGMMGAAIAYVCAKAGLEVVLKDVDQAAADRGK
GYSAALVEKAVGRGRQSQEAGDALLARITATTDAAAAAGADLLIEAVFEDPAVKAQVYAE
VEPHLDPDALLGSNTSTLPITSLAEHVSRPADFIGLHFFSPVDKMPLLEIIRGEATSDET
LYRALDVARQIGKTPIVVNDSRGFFTSRVIGTFINEGIAMLTEGVPAATIEQAASQAGYP
APVLQLSDELNLELMAKIRKASKEAVEASGATWVDHPAFAVIDRMLAEGRAGKLRGAGFY
DYADGKRTGLWAGLRELFPPVADPSAIVLRDLEERMLFAEALETVRCRDEGVIESVADAN
IGSIMGIGFPGWTGGVLQYINGYPDPAHPGVAGFVARARELAERYGDRFEPPASLVEQGE
RGEPYRDRATAPVAVELQVTRTG
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atggcctccacgatccgctgggaccaggacggcgacggcgtcgtcctgctcacgttcgac
gaccccggccagtcggccaacacgatgaacgcggcctatgccgcgtccatgcgcgccacc
gtcgagcgcctcgaggccgagaaggacgacatcgccggcgtcgtcatcaccagcgccaag
aagacgttcttcgccggcggcgacctccacgacctgatccgggtcaccaaggccgacgca
cctgagctggacgccgccctgcgcgagggcaaggccctcctgcggcgcctggagacgctc
ggccggccggtcgtcgccgcgatcaatggcgccgcgctcggcggcggactggagatctgc
ctcgcctgccaccaccgagtgatcgtcgatgaccccaaggccgtcgtcgggttccccgag
gtccagctcgggctgctgcccggcgccggcggggtcgtgcgctcggtgcggatgctcggc
atcaccgacgcgctcatgcagctcctgctgcagggccagcggctgcggccggccaaggcg
ctggagctcggggtcgtcgacgaggtcgtcgcgacccgcgacgagctggtgcccgccgcc
aaggcgtggatcgccgcccaccgcgacgaggagatcgtccagccctgggaggtcaagggc
tacaagatccccggcggcaccccgagcagccccaagctcgcggcgatgctgccggcgttc
cccgccaacctgcgcaagcagatcaagggcgccaactacccggcgccgcaccacatcatg
gccgcggcggtcgagagcacgcaggtcgacttcgacacggcgatcgagatcgagggccgc
tacttcctggacctcgtcacgggccaggtcgccaagaacatgatccaggcgttcttcttc
gacctgcagcaggtcaacggggagcgcggccgcccgtccgacatcccgccgttcgccgcg
acgaaggtcgtcgtgctcggcgcgggcatgatgggcgcggcgatcgcctacgtctgcgcc
aaggccgggctcgaggtcgtgctcaaggacgtcgaccaggccgccgccgaccgcggcaag
ggctactcggccgcgctggtcgagaaggccgtgggccgcggccgtcagagccaggaggcc
ggcgacgcgctgctggcccgcatcaccgccacgaccgatgcggccgcggcggccggcgcg
gacctgctgatcgaggccgtcttcgaggacccggcggtcaaggcccaggtctacgccgag
gtcgagccgcacctggacccggacgcgctgctgggctccaacacctcgacgctgccgatc
acctcgctggccgagcacgtctcgcggccggccgacttcatcggcctgcacttcttcagc
ccggtggacaagatgccgctcctggagatcatccggggcgaggccaccagcgacgagacg
ctgtaccgcgcgctcgacgtggcccggcagatcggcaagacgccgatcgtcgtcaacgac
tcgcgcgggttcttcacctcgcgcgtgatcggcaccttcatcaacgagggcatcgcgatg
ctcaccgagggcgtgccggcggcgacgatcgagcaggccgcgtcgcaggcgggctacccc
gcgccggtgctccagctctccgacgagctgaacctcgagctcatggccaagatccgcaag
gcctccaaggaggccgtcgaggcctcgggggcgacgtgggtcgaccatccggccttcgcg
gtcatcgaccgcatgctggccgagggccgcgcgggcaagctgcgcggcgcgggcttctac
gactacgccgacggcaagcgcaccgggttgtgggccgggctgcgcgagctgttcccgccg
gtcgccgacccgtcggcgatcgtcctgcgcgacctcgaggagcgcatgctgttcgccgag
gcgctcgagaccgtccgctgtcgcgacgagggcgtcatcgagtcggtcgccgacgcgaac
atcggctcgatcatgggcatcggcttccccggctggaccggcggcgtgctgcagtacatc
aacggctatccggatcccgcccaccccggcgtcgccggcttcgtggcccgcgcgcgcgaa
ctggccgagaggtacggcgaccgcttcgagccgccggcctcgctcgtcgagcagggcgag
cgaggcgagccctaccgcgacagggccacggcgccggtggcggtcgagctccaggtcacc
cgtactggatga

DBGET integrated database retrieval system