KEGG   Bacillus sonorensis: S101395_01671
Entry
S101395_01671     CDS       T06571                                 

Gene name
agaF
Definition
(GenBank) Protein-N(pi)-phosphohistidine--sugar phosphotransferase
  KO
K11194  fructose PTS system EIIA component [EC:2.7.1.202]
Organism
bson  Bacillus sonorensis
Pathway
bson00051  Fructose and mannose metabolism
bson02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bson00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    S101395_01671 (agaF)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    S101395_01671 (agaF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bson02000]
    S101395_01671 (agaF)
Enzymes [BR:bson01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     S101395_01671 (agaF)
Transporters [BR:bson02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    S101395_01671 (agaF)
SSDB
Motif
Pfam: EIIA-man
Other DBs
NCBI-ProteinID: ASB88180
LinkDB
Position
1553142..1553585
AA seq 147 aa
MISVIISGHGNFPLALKESSGMIFGEEDNLVAVPFLKGEGIQTLQDKYNQALKDIPEEHE
VLFLVDIFGGTPYNAATPFIVKDQRIDMAAGVNLPILLEALGLRAHMPLKQLLNKLKTIS
QESFQVCSEHLEKMKITANHEREDELL
NT seq 444 nt   +upstreamnt  +downstreamnt
atgatttcagtcattatcagtggtcatggcaattttcccttagcattaaaggagtcctcg
ggaatgatttttggcgaagaagacaacctggtcgcggtgccgtttttaaaaggagaaggc
atccaaacattgcaggacaaatataaccaggcgctaaaggatattccggaggaacatgag
gtgctttttttggtcgatatttttggaggcaccccctataatgcggccacccctttcatt
gtgaaggaccaaagaatcgatatggccgcgggagtgaacctgccgattttgctggaagca
ttaggcctgagagcacatatgccgctcaagcaattgctaaataaattgaaaaccatcagt
caagaaagctttcaagtctgcagcgaacatttagaaaaaatgaagatcaccgccaatcat
gaaagagaggatgaactactatga

DBGET integrated database retrieval system