KEGG   Bacillus sonorensis: S101395_01673
Entry
S101395_01673     CDS       T06571                                 

Definition
(GenBank) Fructose permease IIC component
  KO
K11196  fructose PTS system EIIC component
Organism
bson  Bacillus sonorensis
Pathway
bson00051  Fructose and mannose metabolism
bson02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bson00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    S101395_01673
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    S101395_01673
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bson02000]
    S101395_01673
Transporters [BR:bson02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    S101395_01673
SSDB
Motif
Pfam: EII-Sor TMEM251
Other DBs
NCBI-ProteinID: ASB88182
LinkDB
Position
1554088..1554891
AA seq 267 aa
MSTIQIILLLIIAAITGIGSVLDEGQTHRPLIACTLVGLVLGDLKTGIILGGTLELMALG
WMNVGLAMAPDTAIASVISTILVITADQGIGEGIAVAVALAAAGQALTIFVRTLTVFLIH
RADKYAKDGNMKGIEIMHITAMVFQALRVMIPTLIVALISVSAVQAFLGNIPEVITKGLQ
VGGGIIVVVGYAMVINMMNIPYLKPFFYIGFLLAAFTDFNLVGFGALGLCLALLYQQVMQ
KNSAQGAVAAAADNNLAVYDDDDDLDA
NT seq 804 nt   +upstreamnt  +downstreamnt
atgtctactatacaaattattttgttgttaatcattgcagccattaccggtataggaagt
gttttggatgaagggcagacacaccgtccgctgatcgcctgcacattggtcggtttggtg
ctcggggatttaaaaacgggaatcattttgggcggaacccttgagctgatggcgttgggc
tggatgaatgtcgggcttgccatggcgccggacacagccatcgcttctgtgatttcaacc
attttagtcattactgccgatcaggggatcggcgaaggaattgccgtcgccgtcgctttg
gccgcagcagggcaagcgctgaccatttttgtccgtacgctcacagtctttttgattcac
cgcgctgacaaatatgccaaggatggaaatatgaaaggaattgaaatcatgcatatcacc
gctatggtgtttcaggcgctcagagtcatgattccgacattgattgtagcattgatcagc
gtcagcgccgttcaggctttcctgggaaatattcctgaagtcatcacaaaaggtttgcag
gtgggcggaggaattatcgttgtcgtagggtacgcgatggtgatcaatatgatgaacatt
ccgtatttgaagcctttcttctatatcggctttttattggcggcatttaccgacttcaat
ttggttggattcggcgctctgggactatgcctggcgctcttatatcaacaagtcatgcaa
aaaaacagcgcccagggagcagtcgccgcagcagcggacaacaacctggccgtctatgat
gacgatgacgaccttgatgcctaa

DBGET integrated database retrieval system