KEGG   Bacillus sonorensis: S101395_01674
Entry
S101395_01674     CDS       T06571                                 

Definition
(GenBank) Fructose permease IID component
  KO
K02771  fructose PTS system EIID component
Organism
bson  Bacillus sonorensis
Pathway
bson00051  Fructose and mannose metabolism
bson02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bson00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    S101395_01674
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    S101395_01674
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bson02000]
    S101395_01674
Transporters [BR:bson02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    S101395_01674
SSDB
Motif
Pfam: EIID-AGA
Other DBs
NCBI-ProteinID: ASB88183
LinkDB
Position
1554915..1555742
AA seq 275 aa
METEKRLTKKEIFSMFIRSNFLLGSFNFERVQALGYCYVMIPAIKKLYGPGAKRNEALQR
HLEWFNTHPWLTAPIFGVSAAMEEEMANKKGIDAKAISGMKIGLMGPLAGVGDPIFWGTL
RPVLAALGASLALGGNIAGPLLFFFLINAIRLSTKYYGLKYGYVKGMEILQDLVGNRIQK
LTEGASILGLFVMGALVSKWTTINIPIVVSRIKNDSGKVDVQTVQNILDSIMPGVLPLGL
TLLVAWMLRKGVNPLLIILGIFMIGILGYWAGVLK
NT seq 828 nt   +upstreamnt  +downstreamnt
atggagacagaaaaaagattaaccaaaaaagaaatattcagcatgtttattcgttcgaat
tttttgctcggctcatttaactttgagcgtgtgcaggcattgggatactgctatgtgatg
atcccggcgattaaaaaattgtacggcccgggggcgaaaagaaatgaagcattgcagcgc
cacctcgaatggttcaatacacatccgtggctgacagcgcccattttcggtgtgtcggct
gccatggaagaagagatggccaacaaaaaagggatagatgcaaaagccatcagcggcatg
aaaatcggtttaatggggccgctggcgggtgtaggcgacccgattttctggggaacattg
cgcccggtattggcggctttgggagcctcgctcgctctggggggaaatatagccggacct
ttgctgttctttttcttaatcaatgccataagattaagtacaaaatattatggcttaaag
tacggctatgtcaaaggcatggagattttgcaggatttggttggaaatcgcattcaaaaa
ctgacggaaggcgcttcaatactcggattgtttgtgatgggggcgctcgtctccaagtgg
accaccatcaacattccgatcgtcgtctccagaattaagaatgattccgggaaagttgac
gttcaaactgtgcaaaatattttggacagcattatgccgggagtgctgccgttaggattg
acgctgctcgtagcgtggatgctgcgcaaaggagtgaatccgctcctcattatacttggc
atttttatgatcggtattcttggctattgggctggagtcctgaaataa

DBGET integrated database retrieval system