KEGG   Bacillus sonorensis: S101395_05009Help
Entry
S101395_05009     CDS       T06571                                 

Gene name
ahpF
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bson  Bacillus sonorensis
Brite
KEGG Orthology (KO) [BR:bson00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    S101395_05009 (ahpF)
Enzymes [BR:bson01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     S101395_05009 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 FAD_oxidored GIDA HI0933_like AlaDh_PNT_C Thi4 DAO NAD_binding_7 FAD_binding_3 NAD_binding_8 Glutaredoxin K_oxygenase FANCI_S3
Motif
Other DBs
NCBI-ProteinID: ASB91492
LinkDB All DBs
Position
4768372..4769901
Genome map
AA seq 509 aa AA seqDB search
MVLEANIKAQLNQYMQLMENDIVLKVSAGEDDTSKDMLALVEELASMSSKITIEKAQLNR
TPSFSVNRAGEETGVTFAGVPLGHEFTSLVLALLQVSGRPPKVDQKIIDQIKNISGEFHF
ESYISLTCHNCPDVVQALNMMSVLNPNITHTMIDGAAYKSEVESKNIMAVPTVYLNGESF
GSGRMTLEEILAKMGSGTDVSELSDKDPFDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVLDTMSIENFISVKRTEGPKLAASLEEHVKDYDIDVMNLQRAKGLEKKDLFELELE
NGAVLKSKTVILSTGARWRNIGVPGEQEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVNHVTVLEFAPELKADEVLQKRLYSLPNVTVVKNAQTKEITGDENVNGITY
VDRETGEEKHVELQGVFVQIGLVPNTEWLPETVERNRIGEIAVDKRGETTIPGLFAAGDC
TDSPYNQIIISMGSGANAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttggtacttgaagcaaatatcaaagcacaactcaaccaatacatgcagctgatggagaat
gacattgttctcaaagttagcgcaggtgaagatgatacttctaaggatatgctggctctt
gtggaagagctggcttccatgtcatcgaaaatcacgattgaaaaagcgcaactaaataga
acgccaagcttcagcgtcaatcgcgccggagaagaaaccggcgtgacattcgccggcgtt
ccgctcggacacgaattcacatcattggtactggcgcttttgcaagtgagcgggagaccg
cctaaggttgatcaaaaaatcattgatcaaattaagaacatcagcggtgaattccacttt
gagtcctatatcagcctgacatgccacaactgccctgacgttgtacaggcattgaatatg
atgagcgtgctcaatccgaatatcacgcacacgatgatcgacggcgccgcatacaaatca
gaagtcgaaagcaaaaacatcatggcagtgccaacggtttacctgaacggcgaatcattc
ggaagcggccgcatgacgcttgaagagattcttgcgaaaatgggcagcggcacagatgtc
tctgagctttctgacaaagatccattcgatgtgcttgtcgtcggcgggggtccggcaggc
gcaagtgcggcaatctatgcggcgcgcaaaggcatccgcacaggtattgtagctgaacgc
tttggcggccaggttctggacacgatgagcatcgaaaacttcatcagtgtgaagcgcacc
gaagggcctaagcttgcggcaagccttgaagaacatgtgaaggattatgatattgatgtc
atgaacctgcaacgcgcaaaaggtcttgagaaaaaagatctcttcgaacttgaactcgaa
aacggcgctgtcctgaaaagcaaaaccgtcatcctgtcaacaggtgcacgctggcgcaat
atcggcgtacctggtgaacaagagttcaaaaacaaaggtgtcgcatactgcccgcactgt
gacggcccattgtttgaaggcaaagacgtagccgtcatcggcggcggaaactccggtatc
gaagcagcgattgaccttgcaggtatcgtcaaccacgttactgttcttgaattcgcaccg
gagctgaaagctgacgaagttctgcaaaaacgtctctacagcctccctaacgtgactgtc
gtgaaaaacgcccaaacaaaagaaatcacgggcgatgaaaacgtaaacggcatcacgtac
gtagaccgtgaaacaggagaagaaaaacacgtcgagctccaaggcgtcttcgtccaaatc
ggtcttgtgccgaacacggaatggctgcctgaaaccgtcgaacgcaaccgcatcggcgaa
atcgccgtcgataaacgcggcgaaacaaccatccccggcctattcgctgcaggagactgc
acagacagtccgtataaccaaatcatcatttcgatggggtccggagcgaacgcggcttta
ggcgcgtttgattatctgatccgcaattaa

DBGET integrated database retrieval system