KEGG   Bacillus subtilis PY79: U712_00585Help
Entry
U712_00585        CDS       T02937                                 

Definition
(GenBank) Elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bsp  Bacillus subtilis PY79
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bsp03012]
    U712_00585
   03029 Mitochondrial biogenesis [BR:bsp03029]
    U712_00585
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsp04147]
    U712_00585
Translation factors [BR:bsp03012]
 Eukaryotic Type
  Elongation factors
   U712_00585
 Prokaryotic Type
   U712_00585
Mitochondrial biogenesis [BR:bsp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    U712_00585
Exosome [BR:bsp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   U712_00585
  Exosomal proteins of breast cancer cells
   U712_00585
  Exosomal proteins of colorectal cancer cells
   U712_00585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW DLIC RsgA_GTPase Peptidase_U32_C
Motif
Other DBs
NCBI-ProteinID: AHA76071
LinkDB All DBs
Position
132879..134069
Genome map
AA seq 396 aa AA seqDB search
MAKEKFDRSKSHANIGTIGHVDHGKTTLTAAITTVLHKKSGKGTAMAYDQIDGAPEERER
GITISTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREH
ILLSKNVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVVKGSALKAL
EGDAEWEAKIFELMDAVDEYIPTPERDTEKPFMMPVEDVFSITGRGTVATGRVERGQVKV
GDEVEIIGLQEENKKTTVTGVEMFRKLLDYAEAGDNIGALLRGVSREEIQRGQVLAKPGT
ITPHSKFKAEVYVLSKEEGGRHTPFFSNYRPQFYFRTTDVTGIIHLPEGVEMVMPGDNTE
MNVELISTIAIEEGTRFSIREGGRTVGSGVVSTITE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaaattcgaccgttccaaatcacatgccaatattggtacaattggacac
gttgaccatggtaaaacaactttaactgctgctatcacaacagtacttcataagaaatct
ggtaaaggtacagctatggcgtacgatcaaattgatggtgctccagaagaacgcgagcgc
ggtatcacaatctctactgcacacgttgagtacgaaactgaaactcgtcactatgcacac
gttgactgcccaggacacgctgactatgttaaaaacatgatcactggtgctgcgcaaatg
gacggagctatccttgtagtatctgctgctgatggcccaatgccacaaactcgtgagcac
atccttctttctaaaaacgttggtgtaccatacatcgttgtattcttaaacaaatgcgac
atggtagacgacgaagagcttcttgaactagttgaaatggaagttcgcgatcttcttagc
gaatacgacttccctggtgatgatgtaccagttgttaaaggttctgctcttaaagctctt
gaaggagacgctgagtgggaagctaaaatcttcgaacttatggatgcggttgatgagtac
atcccaactccagaacgcgacactgaaaaaccattcatgatgccagttgaggacgtattc
tcaatcactggtcgtggtacagttgctactggccgtgtagaacgcggacaagttaaagtc
ggtgacgaagttgaaatcatcggtcttcaagaagagaacaagaaaacaactgttacaggt
gttgaaatgttccgtaagcttcttgattacgctgaagctggtgacaacattggtgccctt
cttcgcggtgtatctcgtgaagaaatccaacgtggtcaagtacttgctaaaccaggtaca
atcactccacacagcaaattcaaagctgaagtttacgttctttctaaagaagagggtgga
cgtcatactccattcttctctaactaccgtcctcagttctacttccgtacaactgacgta
actggtatcatccatcttccagaaggcgtagaaatggttatgcctggagataacactgaa
atgaacgttgaacttatttctacaatcgctatcgaagaaggaactcgtttctctattcgt
gaaggcggacgtactgttggttcaggcgttgtttctacaatcactgagtaa

DBGET integrated database retrieval system