KEGG   Bacillus subtilis PY79: U712_01740Help
Entry
U712_01740        CDS       T02937                                 

Definition
(GenBank) putative amino-acid ABC transporter permease protein yckA
  KO
K10009  L-cystine transport system permease protein
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    U712_01740
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsp02000]
    U712_01740
Transporters [BR:bsp02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    U712_01740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AHA76302
LinkDB All DBs
Position
complement(367298..367978)
Genome map
AA seq 226 aa AA seqDB search
MINSIQWEYIFNTKLAIESFPYVIKGIGYTLLISFVSMFAGTVIGLFISLARMSKLALLR
WPAKLYISFMRGVPILVILFILYFGFPYIGIEFSAVTAALIGFSLNSAAYIAEINRSAIS
SVEKGQWEAASSLGLSYWQTMRGIILPQSIRIALPPLANVLLDLIKASSLAAMITVPELL
QHAKIIGGREFDYMTMYILTALIYWAICSIAAVFQNILEKKYAHYV
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatagcattcagtgggaatatattttcaacacgaagctggccattgaatcgttc
ccttatgtcataaaaggcattggttatacactgctcatctcttttgtaagcatgtttgcg
ggaactgtgatcggcctgttcatatcactcgccagaatgtctaaacttgctttgttaaga
tggccggcgaagctctatatctcatttatgcgaggcgttccgattttggtgattttgttt
atcctttatttcgggtttccttatatcggcattgaattttccgctgtcacggctgcttta
atcggctttagcctaaacagcgccgcctacattgcggaaattaaccgttcagccatttca
tccgtcgaaaaaggacagtgggaagccgcatcctcgctgggtctttcctattggcagacg
atgaggggcatcattttgccgcaatcgatacgtattgcgctgcctccgcttgccaatgta
ttgctcgacttgatcaaggcgtcctctctcgctgcgatgattacagtgccggaattgctc
cagcatgcgaaaatcatcgggggcagagagtttgattatatgaccatgtatattctgacc
gctctcatttattgggccatctgctccattgccgcggtctttcagaatatccttgagaaa
aaatacgctcattatgtttaa

DBGET integrated database retrieval system