KEGG   Bacillus subtilis PY79: U712_02360Help
Entry
U712_02360        CDS       T02937                                 

Definition
(GenBank) Alanine racemase 1
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp00473  D-Alanine metabolism
bsp01100  Metabolic pathways
bsp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    U712_02360
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    U712_02360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsp01011]
    U712_02360
Enzymes [BR:bsp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     U712_02360
Peptidoglycan biosynthesis and degradation proteins [BR:bsp01011]
 Precursor biosynthesis
  Racemase
   U712_02360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AHA76423
LinkDB All DBs
Position
500915..502084
Genome map
AA seq 389 aa AA seqDB search
MSTKPFYRDTWAEIDLSAIKENVSNMKKHIGEHVHLMAVVKANAYGHGDAETAKAALDAG
ASCLAVAILDEAISLRKKGLKAPILVLGAVPPEYVAIAAEYDVTLTGYSVEWLQEAARHT
KKGSLHFHLKVDTGMNRLGVKTEEEVQNVMAILDRNPRLKCKGVFTHFATADEKERGYFL
MQFERFKELIAPLPLKNLMVHCANSAAGLRLKKGFFNAVRFGIGMYGLRPSADMSDEIPF
QLRPAFTLHSTLSHVKLIRKGESVSYGAEYTAEKDTWIGTVPVGYADGWLRKLKGTDILV
KGKRLKIAGRICMDQFMVELDQEYPPGTKVTLIGRQGDEYISMDEIAGRLETINYEVACT
ISSRVPRMFLENGSIMEVRNPLLQVNISN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaaaacctttttacagagatacgtgggcggaaattgacttgtccgcgataaag
gaaaatgtcagcaatatgaaaaaacatatcggtgaacatgtccacttgatggcagttgtg
aaagcaaacgcctacgggcatggtgatgcagaaacagcaaaggctgctcttgacgcaggt
gcttcatgcttggccgtggccattttggatgaagcgatttcactgcgcaaaaagggattg
aaggcgcctatattggtgcttggcgcggttcccccggagtatgtggcaatcgctgctgag
tatgacgtgaccttaacaggttattctgttgaatggcttcaggaggcagcccgccacacg
aaaaaaggttctcttcattttcatctgaaggtcgatacggggatgaacagacttggtgta
aaaacagaggaagaagttcagaacgtgatggcaattcttgaccgcaaccctcgtttaaag
tgcaaaggggtatttacccattttgcgacagcggatgaaaaagaaagaggctatttctta
atgcagtttgagcgctttaaagagctgattgctccgctgccgttaaagaatctaatggtc
cactgcgcgaacagcgccgctggactccggctgaaaaaaggcttttttaatgcagtcaga
ttcggcatcggcatgtatggccttcgcccgtctgctgacatgtcggacgagataccgttt
cagctgcgtccggcatttaccctgcattcgacactgtcacatgtcaaactgatcagaaaa
ggcgagagcgtcagctacggagccgagtacacagcggaaaaagacacatggatcgggacg
gtgcctgtaggctatgcggacggctggctccgaaaattgaaagggaccgacatccttgtg
aagggaaaacgcctgaaaattgccggccgaatttgcatggaccaatttatggtggagctg
gatcaggaatatccgccgggcacaaaagtcacattaataggccggcagggggatgaatat
atttccatggatgagattgcaggaaggctcgaaaccattaactatgaggtggcctgtaca
ataagttcccgtgttccccgtatgtttttggaaaatgggagtataatggaagtaagaaat
cctttattgcaggtaaatataagcaattaa

DBGET integrated database retrieval system