KEGG   Bacillus subtilis PY79: U712_04935
Entry
U712_04935        CDS       T02937                                 
Name
(GenBank) Uncharacterized protein yheJ
Organism
bsp  Bacillus subtilis PY79
SSDB
Other DBs
NCBI-ProteinID: AHA76935
LinkDB
Position
1007984..1008232
AA seq 82 aa
MIDNKRFCLYDDKKMKSEWKEGLLCQGICVFIKQFHIGAANLLFCFRERFFRSDRALKSA
VRNISVKKGMELTLHAFFIYKI
NT seq 249 nt   +upstreamnt  +downstreamnt
atgattgacaataaaaggttttgtttatatgatgataaaaagatgaaatcagaatggaag
gagggtttgctatgccaaggaatttgcgtgtttatcaaacagtttcatattggcgcggca
aaccttttgttctgttttcgtgaacggttttttaggtcggaccgcgcgctgaaaagcgct
gtgcgtaacatatcggttaaaaaaggcatggagctgacgcttcatgccttttttatatac
aaaatctaa

DBGET integrated database retrieval system