KEGG   Bacillus subtilis PY79: U712_05750Help
Entry
U712_05750        CDS       T02937                                 

Definition
(GenBank) Arginine biosynthesis bifunctional protein ArgJ
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp00220  Arginine biosynthesis
bsp01100  Metabolic pathways
bsp01110  Biosynthesis of secondary metabolites
bsp01130  Biosynthesis of antibiotics
bsp01210  2-Oxocarboxylic acid metabolism
bsp01230  Biosynthesis of amino acids
Module
bsp_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    U712_05750
Enzymes [BR:bsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     U712_05750
    2.3.1.35  glutamate N-acetyltransferase
     U712_05750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-ProteinID: AHA77098
LinkDB All DBs
Position
1159125..1160345
Genome map
AA seq 406 aa AA seqDB search
MIQLSEDQIVKVTGDVSSPKGFQAKGVHCGLRYSKKDLGVIISETPAVSAAVYTQSHFQA
APIKVTQDSLKHGPTLKAVIVNSAIANACTGEQGLKDAYTMRESFASQLGIEPELVAVSS
TGVIGEHLDMEKIHAGIELLKETPAGSGDFEEAILTTDTVIKQTCYELAIGGKTVTIGGA
AKGSGMIHPNMATMLGFVTTDAAIEEKALQKALREITDVSFNQITVDGETSTNDMVLVMA
NGCAENECLTEDHPDWPVFKKALLLTCEDLAKEIARDGEGATKLIEAQVQGAKNNLDANV
IAKKIVGSNLVKTAVYGTDANWGRIIGAIGHSAAQVTAEEVEVYLGGQCLFKNNEPQPFS
ESIAKEYLEGDEITIVIKMAEGDGNGRAWGCDLTYDYIKINASYRT
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgattcagttaagtgaagatcaaattgtaaaagtaacaggtgatgtatcctcgccaaaa
gggtttcaggcaaagggtgtgcattgcggactgcgctactcgaaaaaagacctcggcgtc
attatcagcgagacaccggccgtgagtgcagcagtttatacccaaagccactttcaggct
gctccgatcaaagtgacacaagacagcttaaagcacggaccgacactgaaagccgtcatc
gtcaacagcgccattgccaacgcctgcacgggagaacagggcttaaaggacgcatacaca
atgcgggagagctttgcttcacagcttggcattgagccggagcttgtcgctgtttcatca
acgggtgtcatcggcgagcatttagacatggaaaaaatccacgcggggatcgaactgctg
aaagaaacacctgcgggatcaggcgattttgaggaagcgattttaacaactgatacggtg
atcaagcagacgtgctatgaactggcaatcggcggcaaaacagtcacgatcggcggagcg
gccaaaggctctgggatgatacacccgaacatggccacgatgctgggatttgtgacaact
gacgcggcaatcgaagaaaaagcgctgcaaaaggcgcttcgggaaatcactgacgtttca
tttaaccaaatcacagttgacggagaaacatccacgaacgacatggtattagttatggcg
aatggctgcgccgaaaacgagtgcctgacagaagaccatccagactggccggtctttaaa
aaagcgctcttgctcacttgtgaggatctagctaaagagattgccagagacggagaaggc
gcgacaaaactaattgaagcccaagtacagggagcgaaaaacaatcttgatgcaaacgtc
attgccaaaaagattgtcggctcaaatcttgtaaaaacggcagtatacggaacagatgcc
aactgggggcggatcatcggagccatcggacactccgcagcacaggtgacggcagaagaa
gtagaggtttatcttggcggccaatgcctgtttaagaataacgaacctcagccattctct
gaatctatcgccaaggaataccttgaaggagatgaaatcaccattgtcatcaagatggct
gaaggggacggaaacgggagagcgtggggctgtgacctgacctatgactatatcaaaatt
aacgcgagctatcgcacgtaa

DBGET integrated database retrieval system