KEGG   Bacillus subtilis PY79: U712_06030Help
Entry
U712_06030        CDS       T02937                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp00061  Fatty acid biosynthesis
bsp00780  Biotin metabolism
bsp01100  Metabolic pathways
bsp01130  Biosynthesis of antibiotics
bsp01212  Fatty acid metabolism
Module
bsp_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    U712_06030
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    U712_06030
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    U712_06030
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsp01004]
    U712_06030
Enzymes [BR:bsp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     U712_06030
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     U712_06030
Lipid biosynthesis proteins [BR:bsp01004]
 Fatty acid synthase
  Component type
   U712_06030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AHA77153
LinkDB All DBs
Structure
PDB: 

Position
1210822..1211598
Genome map
AA seq 258 aa AA seqDB search
MNFSLEGRNIVVMGVANKRSIAWGIARSLHEAGARLIFTYAGERLEKSVHELAGTLDRND
SIILPCDVTNDAEIETCFASIKEQVGVIHGIAHCIAFANKEKLVGEYLNTNRDGFLLAHN
ISSYSLTAVVKAARPMMTEGGSIVTLTYLGGELVMPNYNVMGVAKASLDASVKYLAADLG
KENIRVNSISAGPIRTLSAKGISDFNSILKDIEERAPLRRTTTPEEVGDTAAFLFSDMSR
GITGENLHVDSGFHITAR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttcacttgaaggccgtaacattgttgtgatgggggtagccaacaaacgcagc
atcgcctggggcattgcgcgttctttacatgaagcgggtgcacgtttgattttcacatac
gctggtgaacgcctggagaaatccgttcacgagcttgccggaacattagaccgcaacgat
tccatcatcctcccttgcgatgttacaaacgacgcagaaatcgaaacttgcttcgcaagc
attaaggagcaggtcggtgtaatccacggtatcgcgcattgtatcgcgtttgccaacaaa
gaaaagcttgtcggcgagtacttaaacacaaatcgtgacggcttccttttggctcataac
atcagctcatattctctgactgctgttgtcaaagcggcacgtccgatgatgactgaaggc
ggaagcattgtcactttgacgtaccttggcggagagcttgtgatgccaaactacaacgtc
atgggtgtagcaaaagcttctcttgatgcaagtgtgaaatatttagctgctgacttagga
aaagaaaatatccgcgtcaacagcatttctgccggcccgatcagaacattatctgctaaa
ggcatcagcgatttcaactctatcttaaaagacatcgaagagcgtgcaccgcttcgccgc
acgacaacacctgaagaagtgggcgatacagctgcgttcttgttcagcgatatgtcccgc
gggattacaggtgaaaatcttcacgttgattctggtttccatatcactgcccgctaa

DBGET integrated database retrieval system