KEGG   Bacillus subtilis PY79: U712_10730Help
Entry
U712_10730        CDS       T02937                                 

Definition
(GenBank) Putative RNA methyltransferase YpsC
  KO
K07444  putative N6-adenine-specific DNA methylase [EC:2.1.1.-]
Organism
bsp  Bacillus subtilis PY79
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    U712_10730
Enzymes [BR:bsp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     U712_10730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0020 THUMP MTS Cons_hypoth95 Methyltransf_31 Methyltransf_25 PrmA N6_N4_Mtase Eco57I Phage_clamp_A
Motif
Other DBs
NCBI-ProteinID: AHA78089
LinkDB All DBs
Position
complement(2147928..2149085)
Genome map
AA seq 385 aa AA seqDB search
MKKYTLIATAPMGIEAVVAKEVRDLGYECKVDNGKVIFEGDALAICRANLWLRTADRIKV
QVASFKAKTFDELFEKTKAINWRSFIPENGKFPVIGKSVKSTLASVPDCQRIVKKAIVEK
LKLQSGKANDWIEETGAEYKVEISLLKDQALITLDSSGTGLHKRGYRVDQGGAPIKETLA
AALVQLTNWTPDRPFVDPFCGSGTIAIEAALIGQNIAPGFNRDFVSEDWEWIGKDLWNKA
RLEVEEKANYDQPLTIFASDIDHRMVQIAKENAEEAGLGDLIQFKQMQVKDFTTNLEFGV
IVGNPPYGERLGEKKAVEQMYKEMGQAFEPLDTWSVYMLTSNENFEEAYGRKATKKRKLF
NGFIKTDYYQYWSKVRPQRKKTENA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagtatacactaattgcaacggcgccgatgggcattgaagctgttgtcgcaaag
gaagtacgagatttaggatacgaatgcaaggttgataacgggaaagttatttttgaaggt
gatgcacttgccatctgccgtgcgaacctttggcttagaacagccgaccgcataaaggtt
caggttgcttcttttaaagcgaaaacatttgatgaactgtttgaaaaaacgaaagcgatt
aactggcgctcatttatacctgaaaacgggaaattccctgtcatcggaaaatcggtaaaa
tcaacacttgcaagcgttcctgactgtcagcggatcgtcaaaaaagcaattgtcgaaaag
ctcaagctgcagtccggcaaagccaatgattggattgaagaaacaggtgctgagtataaa
gtggaaatatctttattgaaagatcaggctttgattacactggactcatcagggacgggc
cttcacaaacgaggataccgtgtcgatcagggcggtgcgccgattaaagaaacacttgct
gccgctttggtgcaattaaccaattggacgcctgaccgcccgtttgttgatcctttctgc
ggctccggaacaatcgcgatagaagcggcgctaatcggccaaaacatcgccccgggattc
aaccgcgattttgtatcagaggattgggaatggatcggtaaagatctgtggaacaaagcg
cggcttgaagtcgaagaaaaggcaaattatgatcagccgcttacaattttcgctagcgac
atagaccaccgcatggttcaaatcgcaaaagaaaatgcagaggaagcaggattgggagat
ctaatccagttcaaacagatgcaggtcaaagactttaccacaaatctggaatttggcgta
attgtcggcaacccgccatatggagagcgtctcggcgagaaaaaagccgttgagcagatg
tacaaagaaatggggcaggcgttcgagccgcttgatacttggtctgtgtatatgctgaca
tcaaatgaaaactttgaggaagcatatggcagaaaagcaacgaagaaacgaaaactcttt
aacgggtttattaaaacggattattatcaatactggtcaaaagtaagaccgcagcgcaag
aaaacagaaaacgcataa

DBGET integrated database retrieval system